(data stored in ACNUC10821 zone)

EMBL: AE017262.PE223

AE017262.PE223       Location/Qualifiers
FT   CDS_pept        226626..228215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0226"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03013"
FT                   /protein_id="AAT03013.1"
FT                   /translation="MPERSMKRLMKGAAWLTAASLISKILSAVYRVPFQNMVGDVGFYI
FT                   FQQVYPIYGIAMTLALGGFPVVISKMLAEAEGDVRRQQIIMRAVSRMLRIVSIVIFAFL
FT                   FLFANPIAIMMGDPALSELIRVISFVFLLMPQLAFMRGFFQGEGDMIPTAISQTVEQII
FT                   RVAIILIGAGLALHFNFDLYDAGSMAMSGAFFGGVSGIFILRHFYNKKVRLGEGIQPAV
FT                   FTNKEEKVGIGRTFLRQSVAICVVSSMLILFQLVDSFQVYRLMSDSGIPDFIAKSLKGV
FT                   YDRGQPILQLGLVISTGLALALVPMITAARVQDQQKELKRSVLLAIKITLILAGAETIG
FT                   LIVIMRPLNQMLFQTPDGTFVLQLFMPAVFLSSLIIMLSSILQGFGKITVPAVGVGIGL
FT                   IVKWVTGGILIPRLATVGASVSTCVGLLVILLICYVSLKQTIRVPFVEKTMLFRLIAAL
FT                   ALMAVFPCLFEWLAPLNTRLGSAFQAIVSALVGGGIFLVFSLRYKLLGPKDFVFLPFGS
FT                   KLLALSKLVARK"
     gtgccagaac gttccatgaa gcgactaatg aaaggagcgg cttggctaac cgcggcctct        60
     cttatttcta aaatacttag cgcagtttac cgagtaccct ttcaaaatat ggtgggggat       120
     gtagggtttt atattttcca acaagtatat ccgatatacg gaattgcaat gaccctcgca       180
     ctcggtggat tcccagttgt tatttctaaa atgttagcgg aggcagaagg agatgtaaga       240
     cgacaacaaa taattatgcg cgcagtctca cggatgctcc gaattgtaag tattgtgatt       300
     ttcgcctttt tattcctatt tgccaacccg attgctatca tgatgggaga cccggcatta       360
     tctgaattaa ttcgggtcat cagtttcgtg tttttactta tgccacagct tgcgtttatg       420
     cgtggctttt tccaaggaga aggtgacatg attccgaccg caatctcgca aacagttgag       480
     caaattattc gagtagctat tattttgata ggtgccggcc ttgcacttca ttttaatttt       540
     gatttatatg atgcaggttc aatggcgatg agtggtgcct ttttcggtgg ggtttccggg       600
     attttcattt tgcgtcattt ttataataaa aaggtaaggc tcggggaagg gattcaacca       660
     gcagtattta caaataaaga agaaaaagta ggtattggcc gcacgttctt gcgacaaagt       720
     gttgcaattt gtgtagttag ctccatgctg attttattcc aattagttga ttctttccaa       780
     gtatatcgtt taatgagtga ctcagggatt ccggatttca tcgctaagtc gctaaaaggg       840
     gtatacgacc gcggacagcc aatcttgcaa ttaggtttag tcatctcaac tggacttgcg       900
     ctcgcgcttg tcccaatgat tactgccgca agagttcaag atcaacaaaa agaactaaaa       960
     cgctccgtct tattagcgat taagattaca ttaattttgg caggtgcaga aacaattgga      1020
     ctcatagtta ttatgcgtcc gctaaaccaa atgcttttcc aaacaccaga cggcacattc      1080
     gttttacaat tatttatgcc agctgttttc ctaagctcac taatcatcat gttaagcagt      1140
     attttacaag gtttcgggaa aattactgta cctgcagttg gcgttggaat tggacttatt      1200
     gtaaaatggg taacaggagg cattcttatt ccgagactgg caacagttgg tgcatccgtt      1260
     tcaacatgtg ttggcttact tgtgattcta ctcatttgtt acgtatcact aaaacaaaca      1320
     atccgcgtgc ctttcgttga aaaaacaatg ttgttccggc taattgccgc tttagcgtta      1380
     atggctgtat tcccgtgcct atttgaatgg ttagctccac tcaatacaag actcggtagt      1440
     gcgttccaag caattgttag tgcgttagtt ggcggcggga ttttccttgt tttttcacta      1500
     agatataaat tactcggtcc aaaagatttt gttttccttc cgtttggctc caaattacta      1560
     gcgcttagta agctggttgc acggaaataa                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page