(data stored in ACNUC10821 zone)

EMBL: AE017262.PE225

AE017262.PE225       Location/Qualifiers
FT   CDS_pept        228746..229132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0228"
FT                   /product="putative cell division protein DivIC"
FT                   /note="identified by similarity to SP:P37471; match to
FT                   protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03015"
FT                   /protein_id="AAT03015.1"
FT                   /translation="MKKAKSKVARIENRYIKDTATMKKTRSRRRIALFRRLAFMAIIFA
FT                   VVGGLLTITYTKQVLTLKEKKEKQVQVDKKMVAMKDEQDSLNEQIKKLHNDDYIAKLAR
FT                   SEYYLSKDGEIIFNIPEENSKQKE"
     atgaaaaaag ccaaatcaaa agtggcgaga atagaaaatc gctacataaa agatactgca        60
     acaatgaaaa aaactcgtag tcgtcgccgc attgccctgt tccgtagact tgcttttatg       120
     gctattatct ttgctgtggt gggtgggtta ttaaccatca catacactaa acaagtgttg       180
     acactcaaag agaaaaaaga aaagcaagtg caagtggata agaaaatggt tgcaatgaag       240
     gacgaacaag actcgctaaa tgagcaaatc aagaaacttc acaatgatga ttacatagct       300
     aaattagcaa gaagtgaata ttacttgtcc aaagacggag aaattatttt taatattcct       360
     gaagagaatt cgaaacaaaa agagtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page