(data stored in ACNUC10821 zone)

EMBL: AE017262.PE226

AE017262.PE226       Location/Qualifiers
FT   CDS_pept        229283..229711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0229"
FT                   /product="RNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03016"
FT                   /protein_id="AAT03016.1"
FT                   /translation="MSIEVGNKLQGKVTGITNFGAFVELEGGKTGLVHISEVADNYVKD
FT                   INDILTVGDEVTVKVMNIGDDGKIGLSIRKAVDRPDRPEKSYDRKPKYSKKPAGNYVKP
FT                   AESFEDIMSKFLKDSDERLTTIKRQTESKRGGRGAKRG"
     atgtcgatcg aagtaggcaa caagttacaa gggaaagtta ctgggattac taattttgga        60
     gcatttgtgg agctggaagg tggcaaaaca ggtttagtcc atattagtga ggtagcagat       120
     aactatgtta aagacattaa tgacatctta actgtagggg atgaagttac tgttaaagta       180
     atgaatattg gtgatgatgg taagattggt ctgtccattc gtaaagcagt agatcgtccg       240
     gaccgcccag agaaaagtta cgatcgtaag ccgaaataca gcaaaaaacc tgctgggaac       300
     tatgtgaaac cagccgagag ctttgaagat ataatgtcta aattcttgaa agatagtgat       360
     gaaagactca ctactatcaa acgccaaaca gaatctaaac gtggcggccg aggagcaaaa       420
     cgcggctaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page