(data stored in ACNUC10821 zone)

EMBL: AE017262.PE243

AE017262.PE243       Location/Qualifiers
FT   CDS_pept        259968..261041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0246"
FT                   /product="PIN/TRAM domain protein"
FT                   /note="identified by match to protein family HMM PF01850;
FT                   match to protein family HMM PF01938"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03033"
FT                   /protein_id="AAT03033.1"
FT                   /translation="MLTWVIRVCFLILGGTTGVFSLPALWVKLGIGHILLINNPYTDAL
FT                   IGALIFYLITFWAVKYVEAALNWLEEKLAKIAIATLVYGGLGLFVGLVIAFFASNALSQ
FT                   TNIPLLNSVVPVILTLVLGYLGFRIGISRRNEFGNFVNNRNAKKRTPEEEKTEEKSKKT
FT                   YKILDTSVIIDGRIADILTTGFLDGTVVIPLFVLAELQHIADSSDTLKRTRGRRGLDIL
FT                   NRIQKEDAIQVEMYEGDFEDTPEVDSKLVKLAKVMGGIVVTNDYNLNKVCEFQNVPVLN
FT                   INDLANAVKPVVLPGEKMTVLMVKDGKEHNQGVAYLDDGTMIVVEDGRKFINETIQVEV
FT                   TSVLQTSAGRMIFAKPS"
     atgcttacat gggtaattcg agtgtgtttt ttaattctag gtgggacaac gggagtcttt        60
     tcactacctg ctctatgggt gaaacttgga ataggtcaca ttctgctaat taataatcct       120
     tatactgatg ctctgattgg tgcacttata ttttatctta ttactttctg ggcggtgaaa       180
     tatgtagaag ccgcacttaa ttggttagag gaaaagttag ctaaaattgc tattgcaacc       240
     cttgtttatg ggggacttgg tttatttgta ggtttggtca ttgcgttttt cgcgagcaat       300
     gcattaagtc aaacaaatat tccgctttta aattcagtag taccagttat tttaacatta       360
     gttctaggtt atttagggtt ccgtatcgga attagtcgtc gcaacgaatt tggaaatttt       420
     gtcaataaca gaaatgcaaa gaaaagaaca ccagaagaag agaaaacaga agagaaatct       480
     aagaaaacat ataaaatttt ggatacgagt gtaattattg atggtcgtat tgcagacatt       540
     ttgactactg gatttttaga tggaacggtg gttattccac tatttgtgtt agccgaactt       600
     cagcatattg cggattcatc cgatacgctt aaacgtacaa gagggcgccg gggattagat       660
     attttaaatc gaatccaaaa agaagatgct attcaagtgg aaatgtatga aggtgatttt       720
     gaagatacgc cagaagtgga tagtaaactt gtgaaacttg ctaaagtaat gggcggtatt       780
     gttgttacaa atgattataa tttaaacaaa gtatgtgagt tccaaaatgt acctgtttta       840
     aatattaatg atttagcgaa tgctgtaaaa cctgttgttt tgccaggtga gaaaatgact       900
     gttcttatgg tgaaagatgg taaagaacac aatcaaggcg ttgcatattt agatgatgga       960
     acaatgattg ttgtagaaga tggtcgtaaa tttattaatg aaacaattca agtggaagta      1020
     acgagtgtac ttcaaacatc agcaggaaga atgatttttg ctaaaccatc ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page