(data stored in ACNUC10821 zone)

EMBL: AE017262.PE25

AE017262.PE25        Location/Qualifiers
FT   CDS_pept        27943..28746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0026"
FT                   /product="putative PTS system, mannose-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P08187; match to
FT                   protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02815"
FT                   /protein_id="AAT02815.1"
FT                   /translation="MDLAVWQIILLVILAACTILDALTLVIGLNFPVITGTLAGIIMGD
FT                   MVLGLAIGATLQLMVLGVGTYGGASIPDFTTGAIVGTVFAVLSGQDAEFAIGLAIPVGL
FT                   LMVQLDILARFTNTFFLHRIDSNIASGNISAVKRNIWYGALPWALSRAVPVFIMLTFGQ
FT                   SVVDFILNEIPEWLMGGLRVAGGILPVVGIAILLRYLPTNKFVAYLIIGFVAAAYLKVP
FT                   MLGVALIGVALAIIYFKQNFKNPVAAGANGAALVGEENEDGEYED"
     atggatttag cagtttggca gattatattg ttagttatac tcgcagcttg taccattctt        60
     gatgctttaa ctttagtaat aggacttaat ttccctgtaa taacaggaac gcttgctgga       120
     atcattatgg gtgacatggt gctcggactt gcgattgggg caactttaca gctgatggtt       180
     ctaggtgttg gtacatacgg cggagcatcg attcctgact ttacaacggg agcaatcgtc       240
     ggcacagtat ttgccgtttt atcaggtcaa gatgcggaat ttgcgattgg acttgcaatt       300
     ccagtgggac ttttaatggt tcaattagac attttagcaa gatttacgaa tacatttttc       360
     ttgcaccgca ttgattctaa tattgcttcg ggcaacattt cggcggttaa aaggaacatt       420
     tggtatgggg cgctaccatg ggctttatca cgcgcggttc ccgtatttat catgttgact       480
     ttcggacaaa gcgtggttga ttttattcta aatgaaattc cagagtggct aatgggcggc       540
     cttcgtgtag ctggtggaat tcttccggta gttggtattg cgattctcct tcgttactta       600
     ccaacaaaca aattcgtcgc ttatttaatt atcggatttg tagcagcagc ttatctaaaa       660
     gtaccgatgc taggcgtggc actaattggc gtggctttgg caatcattta ctttaaacaa       720
     aatttcaaaa atccagtggc tgccggagca aatggcgcag cgctagttgg ggaggagaat       780
     gaagatggcg aatacgaaga ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page