(data stored in ACNUC10821 zone)

EMBL: AE017262.PE250

AE017262.PE250       Location/Qualifiers
FT   CDS_pept        266567..267322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0253"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03040"
FT                   /protein_id="AAT03040.1"
FT                   /translation="MEQENEQEWIGGRNPVLEVLRSDRDIHKIYVQEGSQKGVLKQVLT
FT                   LAKERKIQVQFVPKQKIEKVVSGAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIIL
FT                   DELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVR
FT                   TMEELQKRGLWIFGTDAKGSSDYRTMDVDMPLAIVIGSEGFGMSCLVREKCDFLVHLPM
FT                   RGKVTSLNASVAASLLLYEVYRKRFPLEK"
     atggaacaag aaaatgagca agagtggatt ggcgggagaa atcctgttct tgaagtatta        60
     cgatctgata gagatatcca taaaatatac gtgcaagaag gttcacaaaa aggcgtatta       120
     aaacaagtct taacattagc gaaagaacgg aaaatccaag ttcaatttgt acccaaacaa       180
     aagattgaaa aagtagtgag tggagcgcat cagggtgttg cagctcaagt ggcggcttat       240
     caatatgcgg agttagacga tttattcgct gctgctgaag cgaaagatga aatgccattt       300
     ttcattattt tggatgaatt agaagatcca cacaacttag gatcaattat gcgtacagca       360
     gattctgttg gagcacatgg gattattatt ccgaaacgtc gctctgtagg tttgacgcaa       420
     actgtagcca aagcaagtac tggggcgatg gaatatgtac cagtggttcg cgtgacgaat       480
     atggtacgga caatggaaga actacaaaaa cgcgggcttt ggatttttgg aacagatgcg       540
     aaaggtagta gcgattaccg gacgatggat gtggatatgc cgcttgctat tgttattggt       600
     agtgaaggtt ttggaatgag ctgcttagta cgtgaaaaat gtgatttcct cgttcattta       660
     ccaatgcgtg gaaaagttac atcacttaat gcatctgttg cagctagttt gttactttat       720
     gaagtttatc ggaaacgttt ccctctggag aaataa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page