(data stored in ACNUC10821 zone)

EMBL: AE017262.PE256

AE017262.PE256       Location/Qualifiers
FT   CDS_pept        269693..270163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0277"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03046"
FT                   /protein_id="AAT03046.1"
FT                   /translation="MDKAKQIYLEFKREADFLELDFPLFLGDGPGFGELCMDYSEQDGY
FT                   MLYGYERGKRNSEFKTTDFEEFKYEVFLHICWYMGMEFELRHRKEDMRHDDNILETDTR
FT                   KIAFEKTLQLLKMVNPAWIDKAAQGYTAYLNLWRENKNVYFDKEAMEFKVNL"
     atggacaaag caaagcagat ttatctggaa tttaaacgag aagccgattt tttagaactc        60
     gatttcccat tgttcttagg tgatgggcca ggttttggcg agctttgtat ggattatagt       120
     gaacaagatg gttacatgct ttatggttac gaacgtggca aacgaaatag tgaatttaaa       180
     acaacagact ttgaagaatt taaatacgag gttttcttgc atatttgttg gtacatggga       240
     atggagtttg aactgcgcca ccggaaagaa gacatgcggc acgacgataa tattttagaa       300
     acagacacca gaaaaatcgc ttttgaaaaa acattacaac tactaaaaat ggtgaatccg       360
     gcatggatag ataaagcagc acaaggttac acggcgtatt tgaatttatg gcgtgaaaat       420
     aaaaatgttt atttcgataa agaagcaatg gaatttaaag taaatttata a                471
//

If you have problems or comments...

PBIL Back to PBIL home page