(data stored in ACNUC10821 zone)

EMBL: AE017262.PE26

AE017262.PE26        Location/Qualifiers
FT   CDS_pept        28727..29548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0027"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by similarity to SP:P08188; match to
FT                   protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02816"
FT                   /protein_id="AAT02816.1"
FT                   /translation="MANTKTEQDFEKVLKRRDLIAANFRWLFASQICWNYERMMSTGYL
FT                   YSILPTLRKLYKTDDDLKDMMNMHNQFFNTNPMVGGLILGMDMAIEEREKKASKEVVTG
FT                   LKTGLMGPFAGVGDTIFGVILPTIFGSIAAYMGLQGNVTGVVIWVLVNILVVGARFTLL
FT                   PLGYKQGAKLVTEFADRLNALTDAAILLGVTVVGALIPTVIKATVPFVYKSGKVELKMQ
FT                   DMLDQIMPSLVPVLLVALIYALLGHKKMTSTKAILLVMVIAIILFNLKILG"
     atggcgaata cgaagactga gcaggatttt gaaaaagtac tcaagagacg cgatttaata        60
     gcagcaaact ttcgttggtt gtttgccagc caaatatgtt ggaactatga gcgaatgatg       120
     tcgactggtt atctttatag tattttgcca acgcttcgga aactttataa aacagacgat       180
     gatttaaaag atatgatgaa tatgcataac caatttttca atacgaatcc tatggttggt       240
     ggtttgatct taggaatgga tatggcgatt gaagagcgcg aaaagaaagc gtcaaaagaa       300
     gtcgtaactg gtttgaaaac gggtttgatg ggaccatttg ctggtgttgg tgatacgatt       360
     ttcggggtta ttttaccgac gatttttgga tcaattgccg catatatggg acttcaaggt       420
     aatgtgacag gtgtggttat ctgggtatta gttaatattt tggttgtggg agcaagattc       480
     accttacttc ctctaggata taagcaaggt gcaaaactag tgacggaatt tgcggacagg       540
     cttaacgcgt taaccgatgc agcgattctg ctcggggtca cggtcgtcgg ggcattaata       600
     ccaaccgtaa tcaaagcaac tgtcccattc gtttataaat caggaaaagt agagctcaaa       660
     atgcaagaca tgctcgatca aatcatgcca tcactcgttc cagttttact cgtggcgcta       720
     atctatgcac ttttaggcca caaaaaaatg acatctacga aggctatttt attagtaatg       780
     gttattgcga ttattttatt caacctaaaa attctaggtt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page