(data stored in ACNUC10821 zone)

EMBL: AE017262.PE261

AE017262.PE261       Location/Qualifiers
FT   CDS_pept        272767..273381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412713; match to
FT                   protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03051"
FT                   /protein_id="AAT03051.1"
FT                   /translation="MRFLTNNHYYTNDETIKHNRKTWQVMLKGFNMSFTSDNGVFSKNT
FT                   VDFGSRLLIESFELETKIGKILDVGCGYGPMGLTVAKAFPDSQIEMVDVNLRALELAKE
FT                   NAEINKITNTHIYESSVYDSVTANDYQAIISNPPIRAGKRIVHAILEGAYDHLQETGEL
FT                   WIVIQKKQGGPSAEKKMEEVFGNVETVAKDKGYFIFKSVKN"
     gtgcggttct tgactaacaa tcattactac acaaacgacg aaacaattaa acacaaccga        60
     aaaacatggc aagtgatgtt aaaaggtttt aatatgagtt ttacaagtga caatggcgtg       120
     ttttccaaaa atacggtcga ttttggttcg agattattga ttgagtcttt tgagttagaa       180
     acgaaaatag gaaaaatctt ggatgttggt tgtggctatg gtccgatggg gttaacggta       240
     gcgaaagcgt tccctgatag ccaaattgaa atggtggacg ttaatttgcg cgcactggaa       300
     cttgcgaaag aaaatgcgga aatcaataaa attacgaata cgcatatcta tgaaagttcg       360
     gtttatgata gcgtaactgc gaacgattac caagcgatta ttagtaatcc gccaattcgt       420
     gcagggaaaa gaatagttca tgcgatttta gaaggtgctt acgatcactt gcaagaaacc       480
     ggagaacttt ggattgttat tcaaaagaaa caaggcggcc catctgctga aaagaaaatg       540
     gaagaagttt tcggcaacgt tgaaacagtg gcaaaagata agggctattt tattttcaaa       600
     agcgttaaaa attaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page