(data stored in ACNUC10821 zone)

EMBL: AE017262.PE264

AE017262.PE264       Location/Qualifiers
FT   CDS_pept        276184..277410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0267"
FT                   /product="sugar ABC transporter, sugar-binding protein"
FT                   /note="identified by similarity to SP:P29850; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03054"
FT                   /protein_id="AAT03054.1"
FT                   /translation="MKKLLLSISIIVGLSLLASCGVEKEYKPDIKVNEKNVSLKVWVDL
FT                   NQGDFYRKVVDDFKKEHPDKNYDITVIESESGRAQEYVQKDPEAAADVFITPNDRLGQL
FT                   VESGAVYQLTKYTDDIKKNNTPTSIQAATYQDKMYGFPVTAEAMFMYYDKRVFSEDDIK
FT                   TFSGITSKGKLGINLAEAGADYRETPWFIANGTYLYGENGEDPYGTTFNTPEGVQVLNW
FT                   IGELKNNPNVVAVNADEISALRSGKINAVFSGVWNKDAIREVLGENMGVAVYPKADFGS
FT                   GQVDMMAFQGSGIYCVNAFTKSPLDAMELADYITNADVQEKAFKELGKIPSNLEARTSS
FT                   TVEKDDVAKAVIDMTSGKHSVLMPKIPEMNVFWQHMNPLLVDTYKGKIKKEDYPEALDK
FT                   LVKDITPAK"
     atgaaaaagt tacttttgtc catcagtatt attgtcggtt taagtttgtt ggctagttgt        60
     ggtgtagaaa aggaatacaa gccagatata aaagtaaacg agaaaaatgt ttctttaaaa       120
     gtttgggtgg atttaaatca gggtgatttt tataggaaag tggtagatga ttttaaaaaa       180
     gaacatcctg ataaaaatta tgatattacg gttattgaat ctgaatctgg gcgagcacaa       240
     gaatatgttc agaaagatcc agaagctgcg gcggatgtat ttataactcc gaatgaccgt       300
     ctaggacaac tggtagagtc tggtgcggtt taccaattga caaagtatac agatgatatt       360
     aagaaaaata atacaccaac ctccattcaa gctgctacat atcaagataa aatgtatggt       420
     ttccctgtga cggcggaagc gatgtttatg tattatgata agcgcgtttt ttcagaggat       480
     gatattaaaa ctttttctgg aataacgtct aaagggaagc tcggaataaa tcttgcggaa       540
     gctggcgcgg attatcgtga aacaccttgg tttattgcaa atggtacata tctttacggt       600
     gagaacggcg aagatcctta tgggacaacc tttaacactc cagaaggcgt ccaagtattg       660
     aactggattg gtgagctgaa aaataatcct aatgttgtcg ctgtaaatgc agatgagatt       720
     agtgcgctta gatccggtaa aataaatgcc gtttttagtg gggtttggaa taaagatgcg       780
     atacgagaag ttttaggtga aaatatggga gtggcagtat atccgaaggc cgattttgga       840
     agtggtcagg tagatatgat ggctttccaa ggaagcggga tatactgtgt gaacgcattt       900
     actaaatcgc cattagatgc gatggaacta gctgattata ttactaatgc ggatgtgcag       960
     gaaaaagctt ttaaagagtt agggaaaatt ccgagcaatt tagaggcacg aactagttct      1020
     acagtagaaa aggacgatgt ggcgaaagca gttattgata tgacatccgg aaagcactcc      1080
     gttttaatgc cgaaaatacc tgaaatgaac gttttttggc aacatatgaa cccgctatta      1140
     gtagatactt ataaaggcaa gattaagaaa gaagattatc cagaggcgct cgataaatta      1200
     gtcaaagata ttacaccagc gaaatag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page