(data stored in ACNUC10821 zone)

EMBL: AE017262.PE265

AE017262.PE265       Location/Qualifiers
FT   CDS_pept        277428..278765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0268"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:Q04698; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03055"
FT                   /protein_id="AAT03055.1"
FT                   /translation="MMVKKNYFNIFKNGSVSTRLSYVIMGAGNLAHKQIAKGLLFLFSE
FT                   LAFLFFLVFYGITLIQGMATLGTVNQSWNFDKSLGIMVRTPGDNSMLMLIYGIMTVVIC
FT                   VLFLFLYLANIRSACQVEGFQRENKKIPTFKEDLKSLLDNKFHVTLLTIPMIGVVVFTI
FT                   MPLVYMISLAFTNYDHEHLPPRNLFGWVGFVNFKNVLNGDISSTFFPVLGWTLIWALLA
FT                   TATCFFFGVLLALLINHKGVKFKKFWRTIFVITMAVPPFVSLLVMQNLLHAAGPLNTML
FT                   LNWGIIAEPIPFLTDALLAKVSVIFVNMWIGIPVTMLIATGILMNLPKDQLEAARMDGG
FT                   NSFHLFRYITFPQILTVMLPSLIQQFIGNINNFNVIYLLTGGGPSNSNFYGAGDTDLLV
FT                   TWLYKLTVEAADYNLASVIGIVTFILSAAFSLFAYTRTNSYKEGSN"
     atgatggtta agaagaatta ttttaatatt tttaagaatg gttctgtttc tacgagatta        60
     tcttatgtaa ttatgggggc tggtaatttg gcccataagc aaattgcgaa gggacttcta       120
     tttcttttta gtgaacttgc tttcttgttt ttccttgtgt tttatggcat taccttaatt       180
     caaggtatgg cgacattagg gacagttaac caatcgtgga attttgataa gagtttaggt       240
     attatggttc gaacaccggg cgataattcc atgctgatgc taatatatgg gattatgaca       300
     gttgttattt gtgtactatt tctcttcttg taccttgcta atattagaag cgcttgccag       360
     gtggagggct tccagcggga aaataaaaaa atcccaacat ttaaggaaga cttaaagagt       420
     ttgctagaca ataaatttca tgtaacttta ctgacgatcc cgatgattgg ggttgtggtg       480
     tttacgataa tgccacttgt ttatatgatt tctttggctt ttaccaatta tgatcatgaa       540
     catttaccgc caaggaattt atttggatgg gtaggatttg ttaactttaa aaatgtgcta       600
     aatggtgata tttccagtac gttctttccg gtgcttggat ggacacttat ttgggcgctt       660
     ttagctactg ctacttgttt cttttttggc gtattgcttg cacttcttat taatcataag       720
     ggtgttaaat tcaaaaagtt ttggcgcact atctttgtta taactatggc ggtacctccg       780
     tttgtgtcac ttctcgtaat gcagaacttg ttgcatgcag caggaccgct taatacgatg       840
     ttacttaatt ggggaattat agctgagccg ataccatttt tgacagatgc tttgctagca       900
     aaggtatccg tcatatttgt caatatgtgg attgggattc cggtaactat gttaatcgcc       960
     acggggattt taatgaatct accgaaagat caattggaag cggcgcgaat ggatggaggt      1020
     aacagttttc atttatttag atacataact ttccctcaaa tcttaacggt gatgttgcca      1080
     agtctgattc aacaatttat tggaaatata aataacttta atgtgatcta tctcttgact      1140
     ggtggaggac cttcgaatag taacttctat ggtgctgggg atacggattt gctcgtgaca      1200
     tggctttata aattaacagt agaagctgcg gattataatt tagcttcggt tattgggatt      1260
     gtaacattca ttcttagcgc tgcattctct ttatttgcct acacacgtac aaattcttat      1320
     aaagaaggga gcaactga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page