(data stored in ACNUC10821 zone)

EMBL: AE017262.PE273

AE017262.PE273       Location/Qualifiers
FT   CDS_pept        290739..291260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03063"
FT                   /protein_id="AAT03063.1"
FT                   /translation="MGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKVKQLGFKQA
FT                   ILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDFTLNALQID
FT                   KTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPVWDLADVPE
FT                   ALLLLKKISA"
     atgggcgaaa cattaaacac cgtaccaaac acaagatacg accatcaccc tctcgatact        60
     tatccagaag tagtgctacg gaaaaatgcc aaagaaacgc ttgaaaaagt aaaacaactc       120
     ggattcaaac aagcaatcct cagcaatacc gcaacaagtg acacagaagt aattaagcgc       180
     gtattaacta attttggtat catcgattat tttgacttca tttacgcctc caattccgaa       240
     ttacaaccag ggaaaatgga aaagccagac aaaactattt ttgatttcac actaaatgcc       300
     cttcaaattg ataaaacgga agcagtcatg gtcggaaata cattcgaaag tgatattatt       360
     ggtgcaaatc gtgcaggaat ccatgcgatt tggctgcaaa acccagaagt ttgtttgcaa       420
     gatgagcgcc tacctcttgt cgcgccgcca tttgttatcc cagtttggga cttagctgat       480
     gttcccgaag cccttttact attaaagaaa atttctgctt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page