(data stored in ACNUC10821 zone)

EMBL: AE017262.PE275

AE017262.PE275       Location/Qualifiers
FT   CDS_pept        293001..293444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03065"
FT                   /protein_id="AAT03065.1"
FT                   /translation="MKKTRVTWAIVIAIAGLLVSVISLSVNITQNRYNVRGVDSSSQWK
FT                   TGFQKNQTVCAIETKKHWTKGSVKYGVNQTSGTVKTKYSIYSKKNNDRYVLMYKDGYTS
FT                   RNNTYYGEFYGHYAGGKDKFSYKLEKKNNKNVKSQLIVDLFVI"
     atgaaaaaaa cacgtgtcac atgggcaata gttattgcta tagcaggctt attagtttct        60
     gtgatcagtt tatcagtaaa catcacccag aatagatata atgttcgagg agtggattct       120
     agttcccagt ggaaaactgg atttcaaaaa aatcaaactg tttgtgcaat agaaacaaag       180
     aagcattgga caaagggcag tgtgaagtat ggtgtgaacc aaacttctgg aactgttaag       240
     acaaagtata gtatatacag caaaaaaaat aatgataggt atgtattaat gtataaagat       300
     ggatatacat caagaaataa tacatactac ggggaatttt atggtcacta tgcaggcgga       360
     aaagataaat tttcatataa attagaaaag aaaaataata aaaatgtaaa atcacaactt       420
     attgtagatt tattcgtaat ttaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page