(data stored in ACNUC10821 zone)

EMBL: AE017262.PE281

AE017262.PE281       Location/Qualifiers
FT   CDS_pept        303078..304265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0284"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01910"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03071"
FT                   /protein_id="AAT03071.1"
FT                   /translation="MERENIEWNSKKEGVNMERQRKIQILKDIVNIDSTNGHEEQVANY
FT                   LQKLLAEHGIESEKVKYDVDRASLVSEIGSSDEKVLAFSGHMDVVDAGDVSKWKFPPFE
FT                   ATEHEGKIYGRGATDMKSGLAAMIIAMIELHEEKQKLNGKIRLLATVGEEVGELGAEQL
FT                   TQKGYADDLDGLIIGEPSGHRIVYAHKGSINYTVKSTGKNAHSSMPEFGVNAIDNLLLF
FT                   YNEVEKFVKSIDATNEILGDFIHNVTVIDGGNQVNSIPEKAQLQGNIRSIPEMDNETVK
FT                   QVLVKIINKLNKQENMNLELIFDYDKQPVFSDKNSDLVHIAKSVASDIVKEEIPLLGIS
FT                   GTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSIENYLEMVDVYKRIATEFLS"
     atggaacggg aaaacataga gtggaattca aagaaagagg gcgtaaacat ggaacgacaa        60
     agaaaaattc aaatcttaaa agacattgtg aatattgatt cgactaatgg gcatgaagaa       120
     caagttgcga actatttgca aaagttgtta gctgaacacg gtattgagtc cgaaaaggta       180
     aaatacgacg tagacagagc cagcctagtt agcgaaattg gttccagtga cgagaaagtt       240
     ttggcgtttt cagggcatat ggatgtcgtt gatgcgggtg atgtctcgaa gtggaagttc       300
     ccaccttttg aagcaacaga gcatgaaggg aaaatatacg gacgtggcgc gacggatatg       360
     aagtcaggtc tagcggcgat gattattgca atgattgagc ttcatgaaga aaaacaaaaa       420
     ctaaatggca aaattagatt attagcaacg gttggtgaag aagtcggtga acttggagcc       480
     gaacaactaa cgcaaaaagg ttacgcagat gatttagatg gcttgattat cggcgaaccg       540
     agtggacacc ggattgttta tgcgcataaa ggttccatta attataccgt taaatccact       600
     ggtaaaaatg cgcatagttc gatgccggaa tttggtgtta atgcgattga caacttgttg       660
     ctattttata atgaagtaga aaaattcgtg aaatcaattg atgctactaa cgaaatatta       720
     ggcgatttta ttcataatgt caccgtaatt gatggtggaa atcaagtcaa tagtatccct       780
     gaaaaagcgc aactacaagg gaatattcgc tcgattccag aaatggataa cgaaacagtg       840
     aaacaagtgc tagtgaagat tatcaataag ttaaataaac aggaaaatat gaatctagaa       900
     ttaatatttg attatgacaa acaaccagta tttagtgata aaaattcgga tttagtccac       960
     attgctaaga gcgtagcaag cgacattgtc aaagaagaaa tcccattact cggtatttcc      1020
     ggaacaaccg atgcagcaga atttaccaaa gctaagaaag agttcccagt gattattttt      1080
     ggaccaggaa acgaaacccc tcaccaagta aacgaaaatg tttctataga gaattatttg      1140
     gagatggtag atgtttacaa acgaattgcc accgagtttt tatcgtga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page