(data stored in ACNUC10821 zone)

EMBL: AE017262.PE282

AE017262.PE282       Location/Qualifiers
FT   CDS_pept        304412..304828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0285"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03072"
FT                   /protein_id="AAT03072.1"
FT                   /translation="MVKKEERLGVLLWFRFSRFYNRNMKLTNQNLRAVGISTAQFDCIA
FT                   QIGLDKEITQQQLAEKLVVTKGNVTQLLAKLEQLGYITRTKTGREKHITLTEKGQACYR
FT                   ENVPKQEAFQQAQFDKLTRDEQKELLKLLKKLGE"
     atggtaaaaa aagaagaaag gctaggggtt ttgctttggt ttcgatttag tcgattttac        60
     aatcggaata tgaagctgac caatcagaat ttgcgagcgg taggaatttc gacagcgcag       120
     tttgattgca ttgcccagat tggcttagac aaagagatta cacagcaaca acttgccgaa       180
     aaattagttg taacgaaggg aaatgttacc caactcctcg cgaaattaga acaattaggt       240
     tatatcacgc gaacaaagac agggcgcgaa aaacatatta ccctcacaga aaaaggccaa       300
     gcgtgttacc gcgaaaacgt gccaaaacaa gaagcttttc agcaagctca atttgataaa       360
     ttaacaagag acgaacaaaa agaactactt aagctattaa aaaaattagg agagtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page