(data stored in ACNUC10821 zone)

EMBL: AE017262.PE283

AE017262.PE283       Location/Qualifiers
FT   CDS_pept        304835..305794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0286"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03073"
FT                   /protein_id="AAT03073.1"
FT                   /translation="MKLTGIHHVSIFTANARANFDFYTKIMGLRLVKKSVNQDDPYTYH
FT                   LYYGDEIGSPGTALTFFEVPNMAKNHPSRNAISSLSLRVPSDEALHYWDKRLDEHRIFH
FT                   SKPIDQFGRKIIRLKDTDGLPVNLISDETSTQVTEVSPWEDSPVPAEYAIRGLGPVRFS
FT                   VFKKEKTDRLLTKILGFERIGAYEDDDKLVTVFKTGDVGLGGEVHVESRPDLEQGNLGA
FT                   GGIHHVAFRVPTDGDLIGWTEMIQDLGYKNSGYVDRFYFHSLYFRESNGILIELATDEP
FT                   GFQTDFTKEHGTYVDLPPHLENRREDILAHLKPLDTDK"
     atgaaattaa cgggaattca tcacgtatct atttttacag cgaacgcacg agctaacttt        60
     gacttttata caaaaataat gggactacga ctagtgaaaa aatcggttaa ccaagatgac       120
     ccttatacgt accacttata ttacggagac gaaatcggtt cgccggggac agcgctaact       180
     ttctttgaag ttccaaatat ggccaaaaac cacccatcac gcaatgcgat ttctagcctc       240
     agcttacgtg ttccaagcga tgaagccttg cattactggg ataaaagact cgatgagcat       300
     cgcatttttc acagtaaacc aatcgaccaa ttcgggcgca aaattattcg tttaaaagac       360
     acagatggct taccggtcaa tttgatttcc gatgaaacaa gcacacaagt aaccgaggtg       420
     agcccttggg aagatagccc ggttccagca gaatatgcca ttcgcggact tggcccagtg       480
     cgcttctctg ttttcaaaaa agaaaaaaca gatcgtcttt tgacaaaaat attaggcttc       540
     gagcggatcg gtgcctatga agatgacgat aaattagtta cagtattcaa aactggcgac       600
     gttgggcttg gcggagaagt gcatgtggag tcgcgacctg atttagaaca aggaaattta       660
     ggtgctggcg ggattcatca cgtggcgttt cgtgtaccga cagatggcga cttgattggc       720
     tggacagaaa tgattcaaga ccttggctac aaaaattcag gatatgtgga ccgtttttat       780
     ttccactctc tttatttccg cgaaagcaat ggcattttaa tcgaacttgc aaccgatgaa       840
     ccaggtttcc aaaccgattt cacgaaagaa catggaactt acgttgattt accaccacat       900
     ttagaaaatc gccgcgaaga tattttggct catttaaaac cacttgatac agataaataa       960
//

If you have problems or comments...

PBIL Back to PBIL home page