(data stored in ACNUC10821 zone)

EMBL: AE017262.PE284

AE017262.PE284       Location/Qualifiers
FT   CDS_pept        305866..306501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0287"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03074"
FT                   /protein_id="AAT03074.1"
FT                   /translation="MAEGLRTIYFVRHGKTEWNMTGQMQGWGDSPLVAEGIDGAKAVGE
FT                   VLKDTPIDAVYTSTSKRTQDTAAYILGDREIEIQPLEELKEMGFGTWEGIRVTEIDEQH
FT                   PEERAKILHSPETYKAEVNGGETYYELAERLLEGVEKIIAENLSGNILVVSHGMSLTLL
FT                   LYLLQGGTVEDHRKEAPRILNTSISIVEYQNGEFSLKKINEIGHLDLK"
     ttggcagaag gtttacgtac aatttatttt gtaagacatg gtaagacgga atggaatatg        60
     actggacaaa tgcagggatg gggcgattcg ccgctagttg cagaaggtat tgacggggca       120
     aaagcagttg gcgaagtgtt gaaagataca ccaattgatg cggtttatac aagtacaagt       180
     aaacgcacgc aagataccgc ggcttacatt cttggcgacc gcgaaatcga aattcaacct       240
     ctggaagaac taaaagaaat gggatttgga acgtgggaag gcattagagt aactgaaatt       300
     gacgaacaac accctgaaga acgcgcaaaa attctccata gcccagaaac ctacaaagca       360
     gaagtgaacg gcggcgagac ttattatgaa cttgcagaac gactgttaga aggcgtcgaa       420
     aaaatcattg cagaaaatct aagcggcaac attctcgtcg tttctcacgg catgtcgctc       480
     acgttattat tatacttgct gcaaggcgga acggttgaag atcaccgcaa agaagcgcca       540
     agaatcttga acacaagtat tagcatcgta gaataccaaa acggcgaatt ttctcttaaa       600
     aaaatcaatg aaatcggtca tttagactta aaataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page