(data stored in ACNUC10821 zone)

EMBL: AE017262.PE286

AE017262.PE286       Location/Qualifiers
FT   CDS_pept        complement(308500..309585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0289"
FT                   /product="leucine rich repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00560"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03076"
FT                   /protein_id="AAT03076.1"
FT                   /translation="MKKFILASLACTTLISFSPLVGQVEVSAATTNIATAPEKNLQEAP
FT                   PATVDQIFPDDALAFKVAQELGVSEDTVVTQEQLDTIETMVYVDFGVEDLTGMEYLHNL
FT                   KFVDLSQNKISKLENLANLTELETVSLNYNQITDITPLMNSPKLYNLELGVNQISTLPS
FT                   FENLTNLRILNLSSNQLKDISALKDTPQLTNLSISANNISDISVLSECDNLQVFYAESN
FT                   QLTSIEPLRNKTKLEYFDANFNQIKDVTPLSTIPTIRSIKIEENQISDFSSLAGHRLEL
FT                   FDATGQNIYLPDVALGDSTNIVMKDNLGVTLHDWVWYTPGTYQNDTLTWENAGDNSAYF
FT                   LNNQYPTYPSVTVTVYQTVTP"
     atgaaaaaat ttattctagc aagccttgca tgtacgactt tgattagttt tagtcctttg        60
     gtaggacaag tcgaagtaag cgctgctaca acaaacattg ccactgcccc agaaaaaaat       120
     ttacaagaag ctcctccagc cacggttgat caaattttcc cagatgatgc tctagctttt       180
     aaagtcgcac aggaactagg tgtttccgag gatacagtcg ttacacaaga acaactagat       240
     actatcgaaa caatggtata tgtggatttc ggtgtggaag atttaacagg catggaatat       300
     ttacacaact taaaatttgt agatttaagc caaaataaaa ttagcaaatt agagaatctc       360
     gctaatttaa cagaattaga aacggtatca cttaactaca atcaaattac agatattact       420
     ccactaatga actcacctaa attatataac ttagaattag gcgttaacca aatctctact       480
     ttaccatcct tcgaaaattt aactaattta aggatattaa atctaagtag caatcaacta       540
     aaagatattt cggccctaaa agatactcct caattaacta atttatctat ttcagcaaat       600
     aatatatcag acatcagtgt cctttcagaa tgcgataatc tccaagtttt ttatgccgaa       660
     agcaatcaac tgacttctat tgagccatta agaaataaaa caaaactaga atacttcgat       720
     gctaatttta atcaaattaa agatgttaca cctctcagta ccattccaac aattaggtca       780
     ataaaaattg aagaaaatca gattagtgat ttcagctcat tggcaggtca ccgcttagaa       840
     ttgtttgatg ctactggaca aaatatatac cttccagatg ttgcgctcgg cgattccact       900
     aatattgtaa tgaaagataa tctcggagta acattacatg attgggtttg gtacacccca       960
     ggaacttacc aaaatgatac acttacttgg gaaaatgcag gcgataattc cgcttacttt      1020
     ttaaataatc aatatccaac ttacccttct gtcacagtga ctgtctatca aacagtcact      1080
     ccttaa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page