(data stored in ACNUC10821 zone)

EMBL: AE017262.PE294

AE017262.PE294       Location/Qualifiers
FT   CDS_pept        316106..317077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0297"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03084"
FT                   /protein_id="AAT03084.1"
FT                   /translation="MGNLNWAILGPGSIAHEFAEGMRGMNREIYAVGARSLEKGQAFAS
FT                   QYGIENVYDDFDKMLADPAIDVVYIATPHSNHYEFIMKSLHNGKHVLAEKAITVSSEEL
FT                   NEINVLAKEKGLIVKEAMTIFHMPLYKKLREIVESGAIGKLKIIQVAFGSAKEKDPKNR
FT                   FYNMDLAGGALLDIGTYALSFARYFLSETPDEVLTTMKKFETGVDEQSGILLKNKEEEL
FT                   AVVSLSFRAKMPKRGVIACEEGFITVDEYPRASRATVTHTATGKVEEIEVGETSKALEY
FT                   EIIAMEESIATGENTTYQLTNDVITIMSDVRTQWGIKFPFEK"
     atgggaaatt taaactgggc aattcttgga ccaggttcaa ttgcacacga atttgcagaa        60
     ggtatgcgag gaatgaaccg tgaaatttat gcggtaggag cacggagttt agagaagggg       120
     caagcattcg caagtcaata cggaatagaa aatgtatacg atgactttga caaaatgctt       180
     gctgatccgg cgatagatgt agtttatatc gctacaccac actctaacca ctatgaattt       240
     atcatgaaaa gtttacataa cggcaaacac gttttagctg aaaaagcgat aactgtaagt       300
     agcgaagaac ttaatgaaat caatgtgcta gccaaagaga aaggcttaat cgttaaagaa       360
     gcaatgacca tattccatat gccgctttat aaaaagttac gagaaattgt ggaatctgga       420
     gcaattggta aattgaaaat tattcaagtt gcttttggaa gtgccaaaga aaaagatccg       480
     aaaaaccgtt tttataatat ggatttggcg ggtggagcat tacttgatat tggtacgtat       540
     gcccttagtt ttgctcggta ttttttaagt gaaacgccag atgaagtatt aacgacgatg       600
     aagaaattcg aaacaggtgt ggacgaacag tccggaattt tactgaaaaa taaagaagag       660
     gaactagcgg ttgtatcgct atctttccgt gctaaaatgc caaaacgagg tgtcattgct       720
     tgtgaagaag gatttatcac tgtagatgaa tacccgcgtg ccagccgagc aactgttaca       780
     cacacggcaa ctggaaaagt ggaagaaatt gaggttggtg aaacaagtaa agctttagaa       840
     tatgaaatta tagctatgga agagagcatc gcgacaggag aaaacacgac ttatcagtta       900
     acaaatgatg ttatcacgat tatgagcgat gttagaacgc agtggggaat taaatttcct       960
     tttgaaaaat aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page