(data stored in ACNUC10821 zone)

EMBL: AE017262.PE295

AE017262.PE295       Location/Qualifiers
FT   CDS_pept        complement(317115..318215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0298"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q00752; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03085"
FT                   /protein_id="AAT03085.1"
FT                   /translation="MAQLSLEHIYKIYDNKVTAVSDFNLEIDDKEFIVFVGPSGCGKST
FT                   TLRMIAGLEEISKGELSIDGKVMNNVAPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLR
FT                   KMPKDEIKKRVEHAANILGLTEYLKRKPSALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRAEITKLHQQLDTTMIYVTHDQTEAMTMATRIVIMKDGVIQQVGSPKQV
FT                   YDHPVNMFVAGFIGSPAMNFFKGRLEGSNFIGDDFTIEVPEGKLKLLKDRGFDGKDIVF
FT                   GIRPEDIHDEPIVIEANPGYTFKATTIVAELTGAEFMLHSRVGTHEFVARVDARSEHQP
FT                   NEVLTLAFEMSKSHFFDPETEDNLTD"
     ttggcacaat tatcactaga acatatttat aaaatttatg ataacaaagt aactgcggta        60
     tctgacttta atttagaaat cgatgacaaa gaattcatcg tttttgtagg tccatctggt       120
     tgtggtaaat ctacaacttt acgtatgatt gctggactag aagaaatttc aaaaggcgaa       180
     ctatctattg atggtaaagt aatgaacaat gttgcgccaa aagaccgtga catcgcaatg       240
     gtattccaaa actacgcatt atatccgcat atgactgtat atgataatat ggcattcggt       300
     ttaaaacttc gtaaaatgcc aaaagacgaa attaaaaaac gtgttgagca tgcagcaaat       360
     attcttggct taactgaata cttaaaacgt aaaccaagtg cactttccgg tggtcaacgt       420
     caacgtgttg ctctaggtcg tgcaatcgtt cgtgacgcaa aagtcttcct aatggatgaa       480
     ccactttcca acttggatgc gaaattacgt gtgcaaatgc gtgcggaaat cacaaaactt       540
     caccaacaat tagatactac aatgatttac gttacccatg accaaacaga agcgatgaca       600
     atggcaactc gtatcgttat catgaaagac ggtgttatcc aacaagttgg ttcaccaaaa       660
     caagtttacg atcacccagt aaatatgttc gtagccggct ttattggaag cccagcaatg       720
     aacttcttca aagggcgttt agaaggttct aactttatcg gtgatgattt cactattgaa       780
     gtcccagaag gcaaattaaa acttcttaaa gatagagggt ttgacggtaa agatatcgtt       840
     ttcggtattc gtccagaaga tattcatgat gagccaatcg ttattgaagc taatcctggt       900
     tatacgttca aagcaacgac tattgttgcc gagcttactg gtgctgaatt tatgcttcat       960
     agccgtgttg gtacacatga attcgtagca cgtgttgatg ctcgctcgga acaccaacca      1020
     aacgaagtac ttactttagc attcgaaatg tctaaatctc acttcttcga cccagaaaca      1080
     gaagataact taactgatta a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page