(data stored in ACNUC10821 zone)

EMBL: AE017262.PE3

AE017262.PE3         Location/Qualifiers
FT   CDS_pept        3121..4464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0003"
FT                   /product="MATE efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02793"
FT                   /protein_id="AAT02793.1"
FT                   /translation="MMKDMTTGNPTKLIFLFAMPMLIGNLFQQFYTMIDAVIVGKFVSV
FT                   DALAAVGATNSVNFFMISLIIGLMSGISVVVAQYFGFKDFDRLKDVIATATYAVVFSAI
FT                   ILTVAGVLLAKPLLILLRTPANILDDSTIFLTTLFIGILPMSLYNGMAAILRALGNSIT
FT                   PLIFLILSSLMNIALDFLFVVYMDMGVRGAAIATVLSQTAAAIAVIYYAYRHVPFMRIE
FT                   RAKFKLSTPLLKEMVRIGLPSGLQGSFISIGNMALQSLINGFGSSVVAAYTAASRIDSL
FT                   TYQPGIAFGAASSMFAGQNIGAGKIDRVREGFWSGIKVVTAISIGITILVQLFAREFLL
FT                   LFVDSSETEVINIGVSYLLIVSLFYVVVGVLFVVRETLRGTGDAMVPLAMGIFELVSRL
FT                   VIGFVLSLYIGYIGLWWATPVAWITATMLGVWRYKSGAWQKKAVIRRK"
     atgatgaaag atatgacaac aggtaatccg acaaaattaa tttttttatt cgcgatgccg        60
     atgttgattg gaaacttgtt tcagcaattt tatacgatga ttgatgctgt tattgttggg       120
     aaatttgtca gtgtagatgc gctggctgct gttggagcga caaattcggt caattttttt       180
     atgatttctt tgattattgg acttatgagc gggatttctg tcgtagtagc gcagtatttt       240
     gggtttaaag attttgatcg tttgaaagat gttattgcaa cggcgactta tgcggtggtt       300
     ttttcggcga ttattttaac tgttgcagga gttttgctag caaagccatt gctaatttta       360
     cttagaactc cagcgaatat tttggatgat tctactatct ttttaaccac tctttttatt       420
     gggattttac cgatgagtct gtataacgga atggccgcga tacttcgggc gcttggaaat       480
     tcgattacac cgctgatttt tttaatttta tcgtccttaa tgaatattgc acttgatttt       540
     ttatttgtcg tatatatgga tatgggcgtt cgcggggctg ctattgcgac agttctttct       600
     caaacagctg cagcaattgc cgttatttac tatgcttatc gccacgtacc atttatgcgg       660
     atagagcgcg caaaattcaa gctttccacc ccactactta aagaaatggt gcgcattgga       720
     ctaccttctg gattacaagg atcctttatt tctatcggaa acatggctct tcaaagttta       780
     ataaatggat ttggttcatc ggtcgttgcg gcatatacgg cggcgagtcg aattgattca       840
     cttacatatc aaccaggaat tgcttttgga gcagcttctt cgatgtttgc tggtcagaac       900
     atcggtgctg ggaaaattga ccgcgttcgc gaaggttttt ggtcgggaat taaagtagtt       960
     acagctatca gcattggaat aacgatttta gttcaacttt tcgctcggga gtttttatta      1020
     ctatttgttg attctagtga gacggaagtt attaatatcg gtgtaagtta tttacttatt      1080
     gtctctttat tttatgtcgt agtgggagtt ttatttgttg ttcgagaaac actcagaggc      1140
     accggagatg cgatggttcc tttagctatg gggatttttg agttagtttc gagactggtt      1200
     atcggatttg ttttatcgct ttatattggt tacatagggc tttggtgggc tacaccagtt      1260
     gcgtggatta cagctacgat gctcggcgtt tggagatata aatcaggagc atggcaaaaa      1320
     aaggcagtta ttaggcgaaa ataa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page