(data stored in ACNUC10821 zone)

EMBL: AE017262.PE30

AE017262.PE30        Location/Qualifiers
FT   CDS_pept        33167..34042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0027; match
FT                   to protein family HMM PF02016"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02820"
FT                   /protein_id="AAT02820.1"
FT                   /translation="MLAKGDLIGIICCSDGRKKEDEKDLKRLKQVLEKEFGLQVVFAKT
FT                   IFQIDDSPFNGTPEERAAELMKLYQNMDVKMIFDISGGDAANQVLPYLNFNIIKKAAKP
FT                   FIGYSDLTVILNAIFAKTKQPGFNYLLRNLVGEASEIQRVQFQKTFFENQIAINGKSLN
FT                   EFEWSLGEIVGGNIRCFLKLAGTEFMPDVSNKIILLESLGGKEAKIASYVAQLEQLGVF
FT                   SKCLGIVVGEHTEAEKNGEYDRIGILYQQIGLKYKLPVFRTKEIGHSSEAKPCLIGTKV
FT                   NVSRETLTNF"
     atgttagcaa agggcgattt gatagggata atttgttgtt ctgatggtcg aaaaaaagaa        60
     gacgagaagg atttgaagcg ccttaaacaa gtcttagaaa aggaatttgg acttcaggtg       120
     gtttttgcga aaactatttt tcaaatagat gattcgcctt ttaatggtac tcctgaggaa       180
     cgagcagccg aattaatgaa actatatcaa aatatggatg taaaaatgat ttttgacatt       240
     tcaggagggg atgcggctaa tcaagtatta ccatatctta attttaacat tataaaaaaa       300
     gcagccaaac cttttatcgg ctatagcgac ttaaccgtaa tattaaatgc aatttttgcg       360
     aagacgaagc agcctggctt taattattta ctgcgaaatt tagtaggtga agctagcgag       420
     atacaacgag tccaattcca aaaaacattt ttcgagaatc aaattgcgat aaatgggaaa       480
     tcccttaatg agtttgaatg gagcctgggt gagatcgttg gtggaaatat ccgctgtttt       540
     ttaaaactag caggaacaga atttatgcct gacgtctcga ataaaataat tttgttagaa       600
     agtttaggtg gaaaagaggc gaaaattgct tcttatgtag cgcaattaga acagttaggt       660
     gtgttttcga aatgcttagg aatagttgtt ggggaacaca ctgaggctga gaagaacggg       720
     gaatacgaca gaataggaat cttatatcaa cagattggat taaaatataa gttgcctgtt       780
     tttcgaacta aggaaatcgg tcatagcagc gaagcaaaac catgtttaat tggcacaaaa       840
     gttaatgttt cacgtgaaac attaacaaat ttttaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page