(data stored in ACNUC10821 zone)

EMBL: AE017262.PE304

AE017262.PE304       Location/Qualifiers
FT   CDS_pept        327335..328048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0307"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by similarity to SP:P13792; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03094"
FT                   /protein_id="AAT03094.1"
FT                   /translation="MAEKKILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALELVEE
FT                   VQPDLILLDIMLPGRDGIEVCREVRKKYDMPIIMVTAKDSEIDKVIGLELGADDYVTKP
FT                   FSNRELIARVKANLRRHSQVSSNAAEEEENSELEIGSLIIHPDAYVASKRGETIELTHR
FT                   EFELLHYLAKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPAWLV
FT                   TRRGVGYYLRNPEQE"
     atggcagaaa agaaaattct tgtagtagat gacgaaaaac cgattgcgga tatagttaag        60
     tttaatctaa ataaagaagg ctttgatgta tattgcgcct atgatggcga tgaagcgtta       120
     gaacttgtag aagaagttca gccagattta attttactgg atattatgct tccaggtcgt       180
     gatggtattg aggtatgtcg tgaagtacgt aaaaaatatg atatgccaat aattatggta       240
     acagcgaaag attcagagat tgacaaagtt atcggactag aacttggtgc agatgactac       300
     gtaacgaaac catttagtaa tcgcgagtta attgctcgag tgaaagccaa tttgcgccgt       360
     cacagccaag tcagctcaaa tgcagccgag gaagaagaaa acagcgaact agaaattggt       420
     tctttgatta ttcatccgga tgcatatgtg gcttctaaac gtggagaaac aatcgaacta       480
     acacatcgtg aattcgaatt actacattat ttagcaaaac atatgggaca agtcatgaca       540
     cgtgaacatt tacttcaaac cgtttggggc tatgactact tcggcgatgt tcgtacggtg       600
     gatgttaccg ttcgtcgttt acgtgagaaa attgaagata acccaagtca cccagcatgg       660
     ttagtaacta gacgcggagt tggctattat ttacgcaatc cagaacaaga ataa             714
//

If you have problems or comments...

PBIL Back to PBIL home page