(data stored in ACNUC10821 zone)

EMBL: AE017262.PE305

AE017262.PE305       Location/Qualifiers
FT   CDS_pept        328233..330065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0308"
FT                   /product="sensory box histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03095"
FT                   /protein_id="AAT03095.1"
FT                   /translation="MHKMRFFQSVQFKLVIMYLLLIIVAMQVIGAYFVRELEGQLEKNF
FT                   QDSITNSITLLDYNAREEIIKNSDNSVKLQNDIRELLVDYSRASSNLIEVRIVDDKGKI
FT                   LGTSNLNNQGIVGQKSNDPLVKRTLSLGTTSEDKIYKDESNKNNRVWVNVSSIKNKGQV
FT                   IGAIYLVADIESVYKQVDDITNIFITGTLIAMIITAVLGILLSRTITKPIIEMKRQAYA
FT                   MARGNYSRKVKVYGVDEIGELADSFNTLTKRVQEAQAMTEGERRKLSSVLAYMTDGVIA
FT                   TDRRGKVILINTPAEKMLRVKHESANGRSIIDVLDIGDTYQFEDLMEVDGSLTMDRSTL
FT                   DKPYVLRANFSVIQRETGFNNGVIAVLHDITDQEKVDQERRDFVSNVSHELRTPLTSMH
FT                   SYLEALSDGAWEDKEIAPRFLEVTQNETERMIRLVNDLLKLSRMDGGREQLEKSFVNFT
FT                   DFFNHIIDRFEMMKKETIMFKRHIPREPVIIEIDEDKVMQVLDNIISNANKYSPDGGRI
FT                   SFYLKKFEDEIEVSIADEGLGVPDEDLANVFDRFFRVDKARSREMGGTGLGLAIAREVI
FT                   EAHGGRIWAERNKTKGTIIKFTLPYSDLPEDDWE"
     atgcataaaa tgagattttt tcagtccgta caatttaagt tagttattat gtatttgcta        60
     ctaattatcg ttgcaatgca agtaatcggc gcgtattttg tacgtgagct ggaagggcaa       120
     ctggagaaaa attttcaaga ttctattacg aatagtatta cgcttttaga ttataacgct       180
     agagaagaaa ttattaaaaa tagcgacaac tccgtcaagt tacaaaatga tattagagaa       240
     ctcttagtcg attattctcg cgcaagtagc aatttaatcg aagtaagaat tgtagatgac       300
     aaggggaaaa ttctcggcac atctaattta aataaccaag gaattgttgg acaaaaaagc       360
     aacgatccac ttgtaaaacg aacattatca cttggaacga cttctgagga caaaatctat       420
     aaagacgaat cgaataaaaa taaccgcgtt tgggtgaacg tatcctccat caaaaataaa       480
     ggccaagtga taggggctat ttatcttgtc gccgatatcg aaagtgtcta taaacaagtt       540
     gatgatatta caaacatttt catcacaggg actttgattg cgatgattat tacagccgtc       600
     cttggaattc tattatcaag aaccattact aaaccaatta tcgaaatgaa acgtcaagct       660
     tatgcgatgg ctcgcggcaa ctatagccgc aaagttaaag tatacggtgt cgatgaaatt       720
     ggtgaactgg ctgattcttt taatacacta acaaaacgag tccaagaagc ccaagcaatg       780
     actgaagggg agcggcgcaa gttatcctct gtactcgcat atatgactga tggcgtaatt       840
     gcaacagacc gccgcgggaa agtaattctc attaatacgc cagcagaaaa aatgcttcgc       900
     gtgaaacatg aaagtgcgaa tgggcgctcg attattgatg ttttagacat cggagacacg       960
     taccaatttg aagatttaat ggaagtagat gggtcactaa caatggaccg tagtactctc      1020
     gacaaaccgt acgtgcttcg tgccaatttc tcggtcattc aaagggaaac aggctttaat      1080
     aatggggtta tcgcggtact tcacgatatt accgatcaag aaaaagtcga ccaagaacgt      1140
     cgcgatttcg tatccaatgt atcacatgaa ctaagaaccc cacttaccag tatgcatagc      1200
     tatttagaag cattaagcga cggcgcgtgg gaagataaag aaatcgctcc acgtttcctt      1260
     gaagtaacgc aaaatgagac cgaacgaatg attcgtctcg ttaacgatct cctcaaactt      1320
     tccagaatgg atggcggcag agaacaactc gaaaaaagct tcgtgaactt tacggatttc      1380
     tttaaccata ttattgaccg ttttgaaatg atgaaaaaag aaacaatcat gttcaaacgc      1440
     catattccaa gagagccagt catcatcgaa attgatgaag ataaagtaat gcaagtgctt      1500
     gataatatta tttctaacgc caataaatat tcaccggatg gtggccgcat ttccttctat      1560
     ctgaaaaaat ttgaagatga aattgaagta agcattgccg atgaaggttt aggcgtacca      1620
     gacgaggatt tagcaaatgt gttcgaccga ttcttccgtg tagacaaagc acgctcgcga      1680
     gaaatgggag gaacagggtt aggactcgct attgctcgag aagttatcga agcacatggt      1740
     ggtcgaattt gggccgaacg taataaaacc aaaggaacca taattaaatt taccctgcca      1800
     tacagtgact taccggagga tgattgggaa tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page