(data stored in ACNUC10821 zone)

EMBL: AE017262.PE307

AE017262.PE307       Location/Qualifiers
FT   CDS_pept        331387..332226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH4030; match
FT                   to protein family HMM PF03413"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03097"
FT                   /protein_id="AAT03097.1"
FT                   /translation="MDWRKTQMIFIVTLLILNVFLAVIFFNKQLSDDPDTLGNETLEER
FT                   LKADNISHPDLSTKPTSGSIFTTERAAFTTKDVSDLTGQAITLKDNNKQIYSVLQTPVK
FT                   AGKKGSNPEFQKFMESDVYRGESYQFWNYDKDARTLTFNQLINNNMVLFDEAGQITFYL
FT                   DQDDRVISYEQTWMSKQDDLKDKTNLMSATDALEAVYQHGELKQDSDVVSATFGYYTTV
FT                   QLPSGNVYFPVWCFEVKHSGETNYVLVNAKDEQVINQSDNKSTTEPGTELSSRQKTK"
     atggattggc gtaaaacaca aatgattttt attgtgactc tcctcattct taatgttttt        60
     ttagcggtaa tatttttcaa caagcagtta tcagatgacc cagatacact cggaaatgaa       120
     acgctagaag aacgattaaa agcagataat atctctcatc ctgatttatc gaccaaacct       180
     actagcggct ctattttcac tacagagcga gcagctttta caacaaaaga tgtgagcgat       240
     cttacagggc aagccattac gcttaaagat aacaataaac aaatctattc tgtcttacaa       300
     actcccgtaa aagctggcaa aaaaggtagt aacccagaat ttcaaaaatt tatggaatca       360
     gatgtttatc gcggggaatc ctatcaattt tggaattatg acaaagatgc tcggaccctc       420
     acttttaatc aattaattaa taataatatg gttttatttg atgaagcggg ccaaattact       480
     ttttatttag atcaagatga ccgagtgatc tcatacgagc aaacttggat gtccaagcaa       540
     gatgatttaa aagataaaac caatttaatg tccgcaacag atgcattaga agcggtttat       600
     cagcacggag aattgaagca agacagcgac gtggtttctg caacatttgg ctattacacg       660
     acagtacagc taccctctgg aaatgtatac ttccccgttt ggtgttttga agtaaaacat       720
     tctggtgaaa ctaattatgt cctcgtaaat gccaaagacg aacaagtaat taatcaatca       780
     gacaacaaat caaccaccga gccaggtaca gaattatcga gccgtcagaa aaccaaataa       840
//

If you have problems or comments...

PBIL Back to PBIL home page