(data stored in ACNUC10821 zone)

EMBL: AE017262.PE308

AE017262.PE308       Location/Qualifiers
FT   CDS_pept        332347..333177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0311"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03098"
FT                   /protein_id="AAT03098.1"
FT                   /translation="MFANKILTEKDTDQIRFSILASGSSGNATLVETGDQKILIDCGLS
FT                   GKKMEGLFAQVGRDMNDLDAILITHEHSDHIKGLGVLARKYKLPIYANAKTWKAMDNMI
FT                   GEVSSDQKFQFDMETVKTFGSMQVESFGVSHDAIEPMFYIFHKGNKKFVMITDTGYVSD
FT                   RMKGHIAGADAYLFESNHDVEMLRMGRYPWNVKRRILGDEGHVSNEDAAIAMSEVITDQ
FT                   TKRIYLGHLSKDNNMKELARMSVTQTLMAEGIDVGGKLEIFDTDPDNATSIFTI"
     atgttcgcaa ataaaatttt aacggaaaaa gatacggatc aaatccgatt tagtatatta        60
     gccagtggaa gctcagggaa tgccacactt gtcgaaacag gagaccaaaa aattctgatc       120
     gattgtggtt tgagtggaaa gaaaatggaa ggattattcg cgcaagttgg tcgtgatatg       180
     aacgatttag acgcgattct aattactcat gaacattcag atcatattaa aggtcttggt       240
     gtgcttgctc ggaaatacaa actccctatt tatgctaacg cgaaaacgtg gaaagcaatg       300
     gataatatga ttggcgaagt gtcttcagat caaaaattcc aatttgatat ggaaacagta       360
     aaaacctttg gtagcatgca agtggaatcc tttggagtct ctcatgatgc aattgagccg       420
     atgttttaca tatttcataa agggaataaa aaatttgtaa tgataacgga cactggttat       480
     gtaagcgacc gaatgaaagg tcatattgcg ggggctgatg cttatctttt tgaaagtaat       540
     catgatgtag aaatgcttcg aatgggacgc tatccgtgga atgtaaaacg cagaattctt       600
     ggtgacgagg gacacgtgag caatgaggac gctgcaatag caatgagcga agtcattacc       660
     gatcaaacaa aacgaattta tttgggacac cttagtaaag acaacaatat gaaagaactt       720
     gcgagaatga gcgtaacaca aacacttatg gcagaaggta ttgatgttgg gggtaaacta       780
     gaaatttttg acacagaccc tgataatgct acatctatct ttactattta a                831
//

If you have problems or comments...

PBIL Back to PBIL home page