(data stored in ACNUC10821 zone)

EMBL: AE017262.PE31

AE017262.PE31        Location/Qualifiers
FT   CDS_pept        complement(34191..34811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02821"
FT                   /protein_id="AAT02821.1"
FT                   /translation="MTKTKFVIFIALTVITLLLFLVPKGIQYLKSQNPELLNTAESIKL
FT                   QAGEYTVGKDIKVGIYDMQVTKGSLSYYSTRLSKGDEIIGINLLDANKLYFEGSGEVEL
FT                   TPAEFNPIKPSANIFTIQHSGSYEVGKQIPAGKYSLTYTIDKSSKKKPFIQILPSYTDD
FT                   ARIEIQFETKPAYNINLKTGEILTVSKTISEELDTMTVLLKKN"
     atgactaaga ccaaattcgt tattttcata gcactgacag tcattacact gcttctattc        60
     ctcgttccta aaggtattca atatctcaaa agccaaaatc ctgagctatt gaatacagct       120
     gaaagcatta aacttcaagc tggtgaatac actgttggaa aagatataaa agttggaata       180
     tatgatatgc aagtaacaaa gggttcgcta tcttactata gtacaaggct ttctaaaggc       240
     gatgaaataa ttggtattaa tttactagat gctaataaac tgtattttga aggaagcggt       300
     gaagtcgagc ttacaccggc agaatttaat cccattaaac cttctgccaa tatttttaca       360
     atccaacact cagggtctta cgaagttggt aaacaaattc cagctgggaa gtacagcctg       420
     acttatacca ttgacaaaag tagtaagaaa aaacctttta ttcaaatatt accatcttat       480
     actgatgacg ctcgtattga aatacaattt gaaaccaaac cggcatataa tattaattta       540
     aaaacaggag aaatcttgac tgttagtaaa acaatatcag aagaacttga tactatgacc       600
     gtcttactta aaaagaacta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page