(data stored in ACNUC10821 zone)

EMBL: AE017262.PE314

AE017262.PE314       Location/Qualifiers
FT   CDS_pept        337906..338544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0317"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0322"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03104"
FT                   /protein_id="AAT03104.1"
FT                   /translation="MKFLKKYGFYFLLLGVLSDFLTPYILGIFYPELNQMTRVMSVFGD
FT                   VASPVRGAFLVWSVVSGVFFVLALPAIYQSVVKTSRTLAILLASAIGLYGIGDCIFTGL
FT                   FSIDTEQASWTFSTWVHNIGSGLGYAGFLIFPLFLVILYRKTGDKTRSNIYLVLLIVSL
FT                   LSAGVYGLARIPAVNDLPVLDKIGFCQRISFFFNYLPIVVFGIDRIRKP"
     atgaaatttc taaaaaaata cggtttttac tttttattac tcggcgtttt gagtgatttt        60
     ctaacgcctt acatacttgg aattttttac ccagaattaa atcaaatgac gcgggttatg       120
     agtgtgtttg gggatgtggc tagtccggtg cggggagcgt ttttggtttg gtcggtggtg       180
     tctggggtgt tctttgtgct cgctttgccg gcgatttatc agagcgttgt taaaacttcg       240
     cggactttgg cgattttgct tgcttctgcg attggtttgt atgggattgg cgattgtatt       300
     tttacagggt tgtttagtat tgacacggag caggcgagtt ggacattttc gacttgggtg       360
     cataatattg gctcggggct cggttatgcg ggatttttga tttttccgtt gtttctggtc       420
     attctttacc ggaaaactgg cgataaaacc cgcagcaata tctatctagt tttactcatt       480
     gttagtttgc tgtcggctgg tgtttatggg cttgcgcgga ttcctgctgt gaatgacttg       540
     ccggttttag ataaaattgg tttttgtcag cggattagtt tcttttttaa ttacttaccg       600
     attgttgttt ttggaattga tcggattaga aaaccctag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page