(data stored in ACNUC10821 zone)

EMBL: AE017262.PE317

AE017262.PE317       Location/Qualifiers
FT   CDS_pept        complement(341837..342127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0320"
FT                   /product="PTS system, cellobiose-specific, IIB component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03107"
FT                   /protein_id="AAT03107.1"
FT                   /translation="MKNIMLVCNAGMSTGMLAKKIEAASGNTLNVTAYSESEYTDYLDG
FT                   VDLVLIGPQIRFLMPQIKQAVSVPVHAISPVKYGIMDGKGVYEDIQKLIGG"
     atgaaaaata tcatgttagt ttgtaatgct ggtatgtcta caggaatgct tgcgaaaaaa        60
     atcgaagccg cttctggcaa cacattaaac gtcactgctt atagcgaatc cgagtatacc       120
     gattatttgg acggtgtcga cctcgttctt atcgggcctc aaatccgttt ccttatgcca       180
     caaattaaac aggccgtcag cgtcccagtc catgccattt cacccgtaaa atacggcatc       240
     atggatggca aaggggttta cgaagacatc cagaaattaa taggaggata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page