(data stored in ACNUC10821 zone)

EMBL: AE017262.PE32

AE017262.PE32        Location/Qualifiers
FT   CDS_pept        complement(35448..36170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0034"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to SP:P37493"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02822"
FT                   /protein_id="AAT02822.1"
FT                   /translation="MKNNKLIILVVICLFLQAILFMAFDFPFKTLPILDGFPVGLATPV
FT                   VTRLLLYWYLPIIAFSFYISGNLKDLLSSYGFLQISRNYKKEYWLMKQFLKLLIKVILF
FT                   TSLQLALIFIFTPYSIYSTAPFLYLILGYSIMLFTIFSLQYLLELFIDAQKALLLINGY
FT                   VIISILMADLIYQNTTVTWPYYLLLPNYGMGFRTGLIPFTNTSTLLISVPTSLIILLVV
FT                   LLCVFIVAIKKFKTTDIL"
     atgaagaata ataaacttat cattttagta gttatttgtt tgtttctaca agcaatatta        60
     ttcatggcct ttgacttccc gttcaaaaca ttaccaatac tagatggatt tccagtagga       120
     ttagccacac cggtagtaac cagattattg ctttactggt atctcccgat tattgctttt       180
     agtttctata tttcaggtaa tttaaaagat ttattatcta gttatggttt tttacaaatt       240
     tctcgaaact ataaaaaaga atattggcta atgaagcaat ttttaaaact gttaataaaa       300
     gttattcttt ttaccagttt acaactcgct ttaattttta tattcacgcc ctattctata       360
     tattctactg ctcctttttt atacttaata cttggatatt ccattatgct atttactatt       420
     tttagtttgc aatacctttt agagctattt atagatgcgc aaaaagcttt attacttata       480
     aatggatatg taattatttc tattcttatg gcagatttaa tctatcaaaa cacaacagtt       540
     acttggcctt attatttatt acttcctaat tatggtatgg gctttagaac tggattaatt       600
     ccgtttacta atacatctac tttactaatc tcagtaccta ccagtttaat tattttgcta       660
     gtagttttac tttgcgtgtt tatagtcgct attaaaaaat ttaaaacaac agacatttta       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page