(data stored in ACNUC10821 zone)
EMBL: AE017262.PE322
AE017262.PE322 Location/Qualifiers
FT CDS_pept 346304..346510
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="LMOf2365_0326"
FT /product="DNA-binding protein"
FT /note="identified by match to protein family HMM PF01381"
FT /db_xref="EnsemblGenomes-Gn:LMOf2365_0326"
FT /db_xref="EnsemblGenomes-Tr:AAT03112"
FT /protein_id="AAT03112.1"
FT /translation="MIRLRINEILKEREMSQKALCELSGLRPTTVSEMCRGVRTTVNLQ
FT HLETLIDALEIEDFNQILKRDKV"
atgattcgat taagaattaa tgaaatattg aaagagagag aaatgagcca aaaagcattg 60
tgcgagctct ctggacttag accgactaca gtttctgaaa tgtgtagagg agttagaaca 120
actgttaatc tacaacattt agaaacatta attgatgcac tagagataga ggattttaat 180
caaattttaa agagagataa ggtgtga 207
//
If you have problems or comments...
Back to PBIL home page