(data stored in ACNUC10821 zone)

EMBL: AE017262.PE324

AE017262.PE324       Location/Qualifiers
FT   CDS_pept        348172..349026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0328"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03114"
FT                   /protein_id="AAT03114.1"
FT                   /translation="MYNFRVISANEDIFIKTKYRFISELEDFKEFAQTLTDDAGKAKVK
FT                   SGKASSYTRYLIRLIIFYCETHRDNLEELSSFEAVKKLEKIRLDESFKAFNQESNRFYS
FT                   ATLSCYLAYVTFKNSDAEEIMDNQIISTLNNFENPAQVVKENKSTYLVRVPKSRASKRK
FT                   NNNVYSYPRNYVEAIEARRRCGWVCEFNQEHKTFINIKDGKPYVEGHHLIPMAVQDYYD
FT                   NTIDFADNIICLCPTCHRKIHYAVQSEKKEMLIKIFNEREKFYLQHGIEIDRKTLLSFY
FT                   GIF"
     ttgtataatt ttagagttat ttctgctaat gaggacatct ttataaaaac caaatataga        60
     tttatctcag agttagaaga ttttaaagaa tttgcacaaa ctctaactga tgatgctgga       120
     aaagcaaaag ttaaaagtgg aaaggctagt tcatatacta gataccttat acgactaata       180
     attttttatt gtgaaactca cagagacaat ctagaggaat tatcatcatt tgaagcagtg       240
     aaaaaacttg aaaaaataag attagacgaa agttttaaag cattcaatca ggaatctaac       300
     cgtttttata gcgcgacttt aagctgttat ttggcatatg taacatttaa aaattctgat       360
     gctgaagaaa taatggataa ccaaattatt agtactttga ataattttga aaatccagca       420
     caagtagtaa aggaaaataa atcaacttat ttagttaggg tgcctaaaag tagagctagt       480
     aaaagaaaaa ataataatgt ttattcatat ccaagaaact atgtagaagc catagaagca       540
     agaagaagat gtggatgggt atgtgaattt aatcaagagc ataagacttt tattaacatt       600
     aaggatggta agccttatgt ggaaggacat catcttatac ctatggcagt acaggattat       660
     tatgataata caattgattt tgcagataat ataatctgtc tttgtccaac atgtcataga       720
     aaaattcatt atgctgttca aagtgagaaa aaagaaatgt taataaaaat ttttaatgaa       780
     agggaaaaat tttatttaca acatggtata gagattgata gaaaaacact tttaagtttt       840
     tatggtattt tttaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page