(data stored in ACNUC10821 zone)

EMBL: AE017262.PE329

AE017262.PE329       Location/Qualifiers
FT   CDS_pept        353274..353948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0333"
FT                   /product="TENA/THI-4 family protein"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03119"
FT                   /protein_id="AAT03119.1"
FT                   /translation="MFVHGFQEEVGDLWQETLQHPFVQSLADGTLEKEAFYYYLLQDDY
FT                   YLSHFEKVIEKSVEQAGTAELAAEMREVQRRLQQSELLMREQFYPRVGLAERDFSERKP
FT                   APTAYHYTSHLYRMADFGSFGVTIAALLPCYALYADMGKMYEGARSSEPFYQELLDSYV
FT                   DENYQKVVLQQKRLVEQAASMADARELALMKQAFQISVEMEWAFFDMAYKKQNWRGSVN
FT                   YV"
     gtgtttgttc acggttttca agaagaagta ggggatttat ggcaagaaac gttgcagcat        60
     ccatttgtgc agagtttggc ggatgggacg cttgagaagg aggcgtttta ctattatttg       120
     ctccaggatg attattactt gtcacatttt gagaaggtga ttgagaaaag tgtggaacag       180
     gcggggacgg cggaacttgc tgcggaaatg agggaagtac aaaggcggct tcagcaatca       240
     gagttgttga tgcgcgaaca gttttatcca cgggttgggc tagcggagcg tgatttttcc       300
     gagcgcaaac cagcgccaac tgcttatcat tatacttctc acctttaccg gatggcagat       360
     tttggcagtt ttggggtaac gattgcggcg cttttgccat gttatgcgct ttatgcggat       420
     atggggaaaa tgtacgaagg ggcgcggagt tcggagccat tttatcaaga gttgttggat       480
     agttatgtgg atgaaaatta tcaaaaagtg gtgttgcagc agaagcggtt ggtggaacag       540
     gcggcgagta tggcggatgc gcgggagctt gccctcatga agcaggcttt tcaaattagt       600
     gtggaaatgg aatgggcatt ttttgatatg gcttataaaa aacaaaattg gcgtgggagt       660
     gtgaattatg tttga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page