(data stored in ACNUC10821 zone)

EMBL: AE017262.PE33

AE017262.PE33        Location/Qualifiers
FT   CDS_pept        complement(36172..36885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0035"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02823"
FT                   /protein_id="AAT02823.1"
FT                   /translation="MLKSRYFLLIFSMFLFFSVFWFTQNMEYLSFPKNRELVLIMNGSL
FT                   YGYISIKSLCLMLVFPYLIFLLLFSKKEQIVALAREKNRLRFYHKILKDTVIATVLFVG
FT                   LYLSVNLLYSFIFLSNKLLTATHFYSGIFFYFLLLVLFYLAIGFLFRIIYDLTTSTGQA
FT                   LIFGAFVICIVYLIDWIILEGIYWTPLHNLNFFDLWLQNGSISSDIPFILIPNAAVAFI
FT                   LYLISSNTFIKKDFY"
     atgttaaaga gtagatattt tcttctaatt ttttccatgt tcctcttttt ttctgttttt        60
     tggttcacac aaaacatgga gtacctaagt ttccctaaaa acagagaact tgttctcatt       120
     atgaatggta gtttgtatgg gtatatctca atcaaatccc tttgcttgat gcttgttttc       180
     ccgtatctta tctttttact actattttca aaaaaagaac aaattgttgc tttagctaga       240
     gaaaaaaacc gtttacgatt ctatcataaa atattgaaag atacagttat tgcaacagta       300
     ctatttgtag gtttatatct tagcgtaaat ttgctatatt ctttcatttt tctaagtaat       360
     aaattgctca ctgctactca tttttatagt ggaatttttt tttacttctt gctacttgtt       420
     ctcttttatt tagctattgg ttttcttttc agaattatat atgacttaac tacttcaact       480
     ggccaagcgc ttatctttgg agctttcgtg atatgcattg tttatcttat tgattggata       540
     attttagaag gtatatactg gacacctctt cacaatttaa atttctttga tctttggtta       600
     caaaatggtt ctattagttc tgatataccg ttcattctaa ttccaaacgc cgcggtagca       660
     tttatcctat acttgattag ttctaatacc tttataaaaa aggattttta ctag             714
//

If you have problems or comments...

PBIL Back to PBIL home page