(data stored in ACNUC10821 zone)

EMBL: AE017262.PE339

AE017262.PE339       Location/Qualifiers
FT   CDS_pept        362491..363393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0343"
FT                   /product="putative transcriptional activator"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03129"
FT                   /protein_id="AAT03129.1"
FT                   /translation="MGSYGELIREIRLSKGLTQKEVYTGIISRSYAIGFEKGKHEITLS
FT                   LFEEILKRIMVPLDEFFFIYRDFSSTEDDSFWIDFVELSGKNDVVGMQALLDKITLERT
FT                   EQTEVRKAILHTRIQTINHYLRTNVFDESNISDEYKKIIHDYLWKMQTWTLEEVRIFSN
FT                   GISFFEEEVQIHFYQIMLKSYEKYRYYDRGRLLFCHLFANLTDELIIQNKINYANLVLE
FT                   KLKEASETSGSFNSAFYRIVANYYQGAIWMKEGEVEKGYRQAKRAIQTWKELHYEAIAD
FT                   LYSVVLKQFLEKENIQVED"
     atgggttcat atggcgaatt gattcgggaa atacggctat ctaaaggttt gactcaaaaa        60
     gaggtataca caggaattat atctaggtct tatgcaatcg gatttgaaaa aggaaaacac       120
     gagattactt tgagtttgtt tgaagaaatt ttaaagcgga tcatggttcc tttagatgaa       180
     ttctttttta tttacagaga cttttcttcg acagaggatg atagtttttg gattgatttc       240
     gtcgagctat caggtaaaaa tgatgttgta gggatgcagg cgttgctaga taaaataact       300
     ttagagcgaa cggagcagac agaagttaga aaagcgatac ttcatacgag aattcaaacg       360
     attaatcatt atttgcgtac gaatgtgttt gatgaatcga atatttctga tgaatataaa       420
     aaaattattc atgactatct ttggaaaatg cagacgtgga ctttagaaga ggttcgtatt       480
     ttttccaacg gcatatcatt ttttgaggaa gaagtacaaa ttcactttta tcaaattatg       540
     ttgaaatcgt atgaaaagta taggtactat gatagaggaa gactgctatt ttgccatcta       600
     tttgctaatc tgacagatga actcatcata cagaataaaa tcaattatgc gaatctagta       660
     ctcgaaaaat taaaagaagc atctgaaaca agtggtagtt ttaacagtgc tttttatcga       720
     atagtagcca attattatca aggggctatt tggatgaaag aaggcgaagt ggaaaagggc       780
     tatcgccaag ccaaaagagc cattcaaaca tggaaagaac tgcattatga agcaatagca       840
     gatttgtata gcgtggtatt aaaacaattt ttagaaaaag aaaatatcca agtagaagat       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page