(data stored in ACNUC10821 zone)

EMBL: AE017262.PE34

AE017262.PE34        Location/Qualifiers
FT   CDS_pept        complement(36872..37636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0036"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to SP:P37491"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02824"
FT                   /protein_id="AAT02824.1"
FT                   /translation="MKNQFTYLINNKTTQGMFILILFIPCIEIVQLYIMLKPDAVNIHP
FT                   AFAFFLAGSSRGHITQILLLWFLPVLSLLLGADSPIQEYQTGVRNIIINKIGKKAYILQ
FT                   KLAVSFILCFITMLTTLLLNFILVSIVFLGGTYKMGLNGLGSLNTLFDFSIQNPYLADF
FT                   GFGFMACLMAGMAGLIATSSSLFFLNKKFAYPAAFFIWFLMILPNNSIMFIFQPFTEYG
FT                   FEIILPIFLVFSLIVLIIVGVLYLYEVKYVKE"
     atgaaaaatc agtttaccta cttaattaac aataaaacta ctcaagggat gttcatttta        60
     atcttattta taccttgtat tgaaatcgtt caattataca taatgttaaa gccagatgca       120
     gttaatattc atcctgcttt tgcatttttt cttgcaggtt caagccgagg tcatatcact       180
     caaatattat tactttggtt cttacctgtt ttaagtctgt tactcggagc agactcgccc       240
     attcaggaat atcagacagg agttcgtaat attattatta ataaaatagg gaaaaaagct       300
     tatattcttc aaaaattagc tgtaagtttt attctttgtt ttatcaccat gcttacaact       360
     ttattattaa attttatttt agtttctatt gtattcttag gtggcactta taaaatgggg       420
     ttaaatggat taggatcgct taatactcta tttgatttta gcattcaaaa cccctactta       480
     gcagattttg gttttggatt tatggcttgc ttaatggccg gaatggctgg acttatcgct       540
     actagctcca gtctgttctt tttgaataaa aaatttgcgt atccagctgc attttttatt       600
     tggtttctga tgatacttcc aaacaattca attatgttta ttttccaacc ttttacagaa       660
     tatggctttg aaataatttt gcctattttt ctagttttca gtttaatagt tttgataatt       720
     gttggtgtcc tttacttata tgaggtgaaa tatgttaaag agtag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page