(data stored in ACNUC10821 zone)

EMBL: AE017262.PE342

AE017262.PE342       Location/Qualifiers
FT   CDS_pept        368767..369495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412782"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03132"
FT                   /protein_id="AAT03132.1"
FT                   /translation="MYDIYCKEFHKGRGDSLLEKKYQIHLQNHYDATSRQVQKKEIKVL
FT                   KKHNNLLNGEVFPYQICLESTMEYSRFMLWFEKEVQKIVKELWNQHFIIKLTLSQLHFR
FT                   ETILFLEHLKDFSKRITIEFIGEDTPEIKKHFSIQEQEAFFIGKLRMLKKWKFIISKHI
FT                   EGCSVEQTLAFTPCLHEIKYTMSQQARMEENIIDLHMFIDFWEYWATHKKLKFVVEVKE
FT                   KDFITKSLMHKKVHVQFENA"
     atgtatgata tttattgtaa agaatttcac aaaggaagag gcgattcttt gttagagaaa        60
     aagtatcaaa tccatttaca aaatcattac gatgcaacga gtagacaagt gcaaaagaaa       120
     gaaataaaag tcttaaaaaa acacaataat ttattaaatg gggaagtttt tccatatcaa       180
     atttgtttag aaagcacgat ggaatattca agatttatgt tatggtttga aaaagaagtc       240
     caaaaaatcg tgaaagaact ttggaatcaa cattttatta tcaaactaac attatcccaa       300
     ttgcatttcc gcgaaaccat tctcttttta gagcatttaa aagattttag taaacggata       360
     acgattgaat ttatcggtga agacacacca gaaattaaaa aacacttttc catccaagaa       420
     caagaagcgt tttttatagg gaaactaaga atgctaaaaa aatggaaatt cattatttct       480
     aaacatatcg aaggctgctc agtggaacaa acccttgctt ttaccccgtg tctacatgaa       540
     ataaaataca cgatgagtca gcaagcacga atggaagaaa atattatcga tttgcacatg       600
     ttcatcgatt tttgggaata ttgggcaaca cataaaaaat tgaaattcgt agtcgaggtg       660
     aaggagaaag attttattac gaagtctttg atgcataaaa aggtccacgt acaatttgag       720
     aatgcgtag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page