(data stored in ACNUC10821 zone)

EMBL: AE017262.PE343

AE017262.PE343       Location/Qualifiers
FT   CDS_pept        complement(369650..371506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0347"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03133"
FT                   /protein_id="AAT03133.1"
FT                   /translation="MKLSKFFTIIALSATVTSSLPIPMVKAESTTANETKIENQLPKTD
FT                   LKETPKEKTTNNNLKNQLVQAGTKTYNDYFPDDNLAKAVAEKMNKNVDESVTVEELAKI
FT                   TKLDARSQGIEDSTGIEYLTGLEILYLEDNQLKSIDVSKNLNLKDLACSNNPLANLDVS
FT                   KNLALEELTCENNELTQLDVSKNTALEYLYCPRNQLTKLDVSKNSALRYLACDVNQLTS
FT                   LDVSQNPALTNLGCTKNQLTDLDVSQNPNLSTLVCSDNQLTNLDVSQNQALAYLTCDNN
FT                   GLKNIDIDQNLALIELSCENNQLTNLDTTQNLALEILYCDDNQLTNLDVRKNVNLLILS
FT                   CNNNQLTNLAVGETILDVSCNNNQLKDISSLPDYLTAENGEYQAMDQTLVGPIQTTQNN
FT                   TLVYAVPTDLLDKDGNIVSIIKPENGGVYDAATRTITWENLPDSGEVSYTFESNDYGVF
FT                   SGRVTVPYTGKETVSISSDDEISYKEGTTKTEEAFLTDIHASVTPATETITSNFADVVD
FT                   LQTPGKYVVKLSVAESDITKDVIVYVTEEPSKDNPVAPVPPKDPDNKVADNDQNTEKPQ
FT                   VKVDEKTLPKTGDITSLSLSLAGIICLSFGILFFIKRKKKTV"
     atgaaactgt ccaaattttt tacaataatt gcattaagtg ccaccgttac aagtagccta        60
     ccgataccaa tggtaaaagc agagagcaca accgcaaatg aaactaaaat cgaaaatcaa       120
     ttaccaaaaa cagatttaaa agaaacaccg aaagaaaaaa caacgaataa caacctgaaa       180
     aatcaacttg tccaagcagg aaccaaaact tataatgatt actttccaga tgataattta       240
     gctaaagcgg tagcagaaaa aatgaacaaa aacgtggatg aatctgtaac tgtcgaggaa       300
     ttagctaaaa taactaaact agatgcacgg agccaaggca tagaagatag cactggaatc       360
     gaatatttga ctggattaga gatactttat cttgaggata atcaactaaa aagtatagat       420
     gtcagtaaaa atctaaatct aaaagacttg gcttgctcta acaacccgtt agcgaattta       480
     gatgttagta aaaatcttgc tttagaagaa ttgacttgtg aaaacaatga attaacacaa       540
     ctagatgtta gcaaaaatac agctttagag tatttgtatt gccctagaaa tcagttaaca       600
     aagctagatg ttagtaaaaa ctccgcttta cgttatttgg cttgcgatgt caatcagtta       660
     accagtttag atgttagtca aaatccagct ttaacaaatc ttggttgtac taaaaaccaa       720
     cttacagatt tagatgttag ccaaaatccg aatttaagca ctttggtttg ttctgataac       780
     cagttaacca acttagacgt tagccaaaat caagctctag catatttgac ttgtgataac       840
     aatgggttga agaatataga tattgatcaa aatctagctt taatagagtt atcttgtgaa       900
     aacaatcaac taacgaattt agatactacc caaaatctag ctttagagat tttatattgc       960
     gatgacaatc agctaacgaa tttagatgtt agaaaaaacg taaatttatt aattttatct      1020
     tgtaataaca atcaactaac gaatctagct gttggagaga caatattgga tgtaagctgt      1080
     aataataacc agctaaaaga tattagttcc ttaccagatt atcttactgc tgagaatggc      1140
     gagtaccaag caatggatca aacattagta ggtccaatcc aaacgacaca aaataataca      1200
     cttgtatacg ctgttcctac agacctgtta gataaggatg gtaacattgt ttccatcata      1260
     aaaccagaaa atggtggggt ttatgatgca gctactagaa ctattacgtg ggaaaattta      1320
     ccagatagcg gagaagtgag ttacacattt gaaagcaatg actatggtgt gttttctgga      1380
     agagttactg tgccatatac aggaaaagaa actgtcagca tttctagtga tgatgagatt      1440
     agttacaaag aaggcactac aaaaacagag gaagccttcc tcacagatat ccatgcaagc      1500
     gtaactccag caacagaaac catcactagc aattttgctg acgtagtaga cttacaaaca      1560
     ccaggtaaat atgttgtaaa actaagcgtg gcagaatcag atattacgaa agacgtcatt      1620
     gtgtatgtga cagaggaacc aagtaaagat aatcctgtcg ctcctgttcc accaaaagat      1680
     ccagataaca aagtagcaga caatgaccaa aatacggaaa aaccccaagt aaaagtagac      1740
     gaaaagacgt tgccaaaaac aggtgatatt actagcttaa gtttgtcatt ggctggaatt      1800
     atttgcttaa gctttggtat tctatttttc atcaaacgaa agaaaaaaac agtttaa         1857
//

If you have problems or comments...

PBIL Back to PBIL home page