(data stored in ACNUC10821 zone)

EMBL: AE017262.PE346

AE017262.PE346       Location/Qualifiers
FT   CDS_pept        375686..381013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0350"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00560;
FT                   match to protein family HMM PF06458; match to protein
FT                   family HMM PF07523; match to protein family HMM PF08191;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03136"
FT                   /db_xref="GOA:Q723X5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723X5"
FT                   /protein_id="AAT03136.1"
FT                   /translation="MKKKFSIVIISVLLLGYLAPFDTLLVGADETTVTEDTTVKTAETE
FT                   TATEATESESGSDNEKAEEPKEAEASKETTEKEEKAKTKEPASNIKTEINTDKSQLKQT
FT                   NLKAVVPAGSTYNSLFPDDNLAKKLAVIITGNAAATGNESVDSAALLAISQLDLSGETG
FT                   NDPTDISNIEGLQYLENLTSLNLSENNISDLAPIKDLVNLVSLNLSSNRTLVNLSGVEG
FT                   LVNLQELNVSANKALEDISQVAALPVLKEISAQGCNIKTLELDNPAGAILPELETFYLQ
FT                   ENDLTDLTSLAKLPKLKNLYIKGNASLKSLATLKGATKLQLIDASNCTDLETLGDISGL
FT                   SELEMIQLSGCSKLKEITSLKDLPNLVNITADSCAIEDLGTLNNLPKLQTLILSDNKDL
FT                   TNINAITDMPQLKTLALDGCGITSIGTLDNLPKLEKLDLKENQLTSISEINDLPRLSYL
FT                   DVSVNYLTTIGELKKLPLLEWLNVSSNRLSDVSTLTNFPSLNYINVSNNVIRTVGKMTE
FT                   LPSLKEFYAQNNNVSDISMIHDMPNLRKVDASNNLITNIGTFDNLPKLQNLDVHSNRIT
FT                   NTSVIHDLPSLETFYAQNNLITNIGTMDNLPELTYVDLSFNRIPSLAPIGDLPKLEILK
FT                   VTDNYSYLRSLGTMDGVSKLRNLELQNNYLNYTGTEGNLSALSDLTNLTELNLRDNGYI
FT                   SDISGLSTLSRLIYLNLDSNKIKDISALSNLTTLQELTLENNQIEDISALSDLDNLNKL
FT                   ALSKNKIIDISPAANMVNRGASVTASNQTYTLPTVLSYQSSFTIDNPVVWYDGTPLAPS
FT                   SIAHSGTYKDGEITWTNMTAASSSTEFNFNRLKDGLTFSGTITQPYKSAVKVTANAEQT
FT                   YTIGDTISEEQFLKDVNAKSSDGAPVTSDFATVVDLNTFGEYEVTLTSEKDGIQGDSCK
FT                   VIVKVLHGAPVISADQTINYDKHATITEKQFLEDVHASTDLNTAITTNFSTAVNLNKGG
FT                   DYTVALNSENEDGVKAETVYVTVTVDKDPAPIISAKTDITYDKFSKKTEAAFLDDIDAD
FT                   TNDGSIITSNFATAVNLDKAGDYTVTLNSINSDGVASTPTAIIVHVEKEKIATISANTA
FT                   QQYEKYAEINETQFLKDVHASINASPTTAVLESDFETVVKLDVPGTYTVTITATNEDGG
FT                   VSAPKEVSVIVKKLPAPEITADKEITYPKFDEVSEAEFLSDIHATINEKNVTITSNFSA
FT                   DVNLNKAGDYTVTLNATNEDGVKATPVEVIVHVQQGERPVITADATISYDKFANITEAK
FT                   FLEDIHATSSDGQSSTVITSNFETATNFKTAMSYTVTLNAVNEDGISAEPVAVTVTINK
FT                   EPAATLKADAEVSYAKNEAVTESDFFKDVHLEGAEAPSTAKATSNFDSVVDRSKTGDYT
FT                   VTINATNEDGAVSTPIEVIVHIGAESAPVITANAEVKYNKHEQTDERRFLYDSDAKIDE
FT                   ANVEIKTDFAEKVDINKVGTYTVTLTATNEDGQAANPVEVSVIVSDAAAEKVNVKYVDE
FT                   NGAEISAAETLTGNLDDAFSIDAKSIAGYKCDATLSGVFSTVEQTVVFHYKAIEPGVVT
FT                   IKYEDANGKAVAEDKQITGEVGDDFEAEAQTVSGYSCRAIASGKITEEPQTITFTYTTA
FT                   TPSKKSGEITVQYVDESGKKLADSKKVTGDIDDSYSVEAKAIDGYSVVGDDSAKGVFTE
FT                   KSQTVTFKYKKNTQVSKDEPKVKGKTNQPPSADTKLKVDNNTLPATGDTENMALAVLIG
FT                   FNMLLVASIFLFRKPKTNQ"
     ttgaaaaaga aatttagtat agttattatc agcgtattgt tacttggtta tttagcgcct        60
     tttgatactc tattagtagg tgcagatgaa accactgtca ccgaagatac gacagtgaaa       120
     acggcagaaa cagaaactgc tactgaagct acagaaagcg aatctggttc agacaatgaa       180
     aaggcagaag agccaaaaga agcagaagca agcaaagaaa cgacagaaaa agaggaaaaa       240
     gcgaaaacaa aagaaccggc ttctaatatt aaaacagaaa ttaatacaga caaaagtcag       300
     ttgaaacaaa ctaatttaaa agcagtagta ccagcaggaa gcacatataa ttctttgttt       360
     ccagacgaca atcttgctaa aaaattagcc gtgattatca caggaaatgc ggctgcaaca       420
     ggtaatgaat cagtggatag tgcagctctt ttagcaataa gccaacttga tttgagtggg       480
     gaaacgggca atgacccaac ggatatttcc aatattgaag gattacaata tttagagaat       540
     ttaacgagcc tgaatttaag tgagaataat atatctgact tggccccaat taaagatttg       600
     gtgaacctgg tttcacttaa cctttcttcc aatcgaacat tagtaaatct ttcaggggtg       660
     gagggtttag ttaatttgca agaacttaat gtctctgcaa ataaggcgtt agaagatatt       720
     tcacaagttg cagcattacc agtgttaaaa gaaattagtg cgcaaggctg taatattaaa       780
     acattggaat tagataatcc agctggcgct attttgccag aactagaaac attttacttg       840
     caagaaaatg atttaaccga cttaacttca ttagcaaaac ttccaaaact aaagaatctc       900
     tatattaaag ggaatgcttc tttaaaaagt ttagcgacat taaaaggggc gacgaagctt       960
     caattgattg atgcgagtaa ctgtaccgat ttagaaacgc ttggagatat tagcgggctt      1020
     tcggaactcg aaatgattca attaagtggt tgtagtaaac tgaaagaaat cacaagcttg      1080
     aaggacttgc ctaatttggt gaatattacg gcagatagct gtgcgattga agatttagga      1140
     acactgaata atttaccgaa attacagaca ttaattctct cagataataa agatttaacc      1200
     aatattaatg caattaccga tatgccacaa ttaaaaacat tagccttgga tggctgcgga      1260
     attacatcta ttggaacgct tgataacctt cctaaattag aaaaattaga tctcaaggaa      1320
     aatcaactaa ctagtataag tgaaataaac gacttacctc gattaagcta tttagatgta      1380
     agtgtaaatt atcttacaac aataggggaa ttaaaaaaat taccactatt agaatggttg      1440
     aatgttagtt cgaataggtt atcagatgtg agtacactaa caaatttccc gagtttaaat      1500
     tatattaatg tatcaaataa tgtcattagg acagtcggta aaatgactga attaccttca      1560
     ctgaaggaat tttacgctca aaacaacaat gtatcagata tttcgatgat tcacgatatg      1620
     ccgaatttaa gaaaagtgga tgcgagtaat aacttaatta caaatatagg tacctttgat      1680
     aatttaccaa aattgcaaaa cctagatgtg cattcaaata gaattacaaa tacatccgtt      1740
     atacatgatt taccaagttt ggagacgttt tatgcgcaaa ataatttgat taccaatatt      1800
     ggtacgatgg ataatttacc agaattaact tatgtagatt tatctttcaa cagaatacca      1860
     tcacttgctc caattggcga cttacccaag ttagaaatat taaaagttac agacaattat      1920
     tcttatttaa gaagcctagg aacgatggac ggtgtttcta agctgagaaa tttagaatta      1980
     caaaacaatt accttaatta cactggaaca gaagggaact taagtgcatt aagtgatcta      2040
     acaaatctaa cggaattaaa tttgcgagat aatggttata ttagtgatat aagtgggctt      2100
     tccaccctat caagactaat ctacttaaat ttagattcca ataaaattaa agatatttct      2160
     gccttatcta atttgacgac tcttcaagaa ttaacacttg aaaacaacca gattgaagat      2220
     atttcagcac ttagtgatct ggataattta aacaagctag ctctatcaaa aaataaaatt      2280
     attgatatta gtcctgccgc taatatggtt aatcgggggg cgagtgttac tgcgagtaat      2340
     caaacatata cattgccaac tgtattatca tatcaaagct catttaccat agataatccg      2400
     gttgtttggt atgacggcac accactagcg ccatcatcta tagcgcactc tggtacttac      2460
     aaggatgggg aaataacttg gactaacatg accgcagcct ccagttccac tgaatttaac      2520
     tttaataggc taaaagatgg tttaaccttc tcaggaacaa tcacccaacc ttataaatct      2580
     gcagttaaag taactgcaaa tgcagagcaa acttatacaa ttggtgatac tatttcagag      2640
     gagcagtttt taaaagatgt taatgcaaaa tcatcggacg gggctcctgt tacaagtgat      2700
     tttgctacag tggtggattt aaacactttt ggtgaatatg aagttactct aacttctgaa      2760
     aaagatggaa tccaagggga tagttgcaaa gtaattgtca aagttcttca cggagcgcct      2820
     gtcatttcgg cagaccaaac aattaattat gataaacatg cgactattac agagaaacaa      2880
     tttttagaag atgttcatgc gagtacggat ttaaatacag ctattacaac taattttagt      2940
     acagcagtta acttgaataa aggcggagat tataccgttg cgctaaattc tgaaaatgag      3000
     gacggcgtga aagctgaaac ggtctatgtc actgttactg tagacaaaga tccggcgccg      3060
     attataagtg cgaaaactga catcacttat gacaaattct ctaaaaaaac cgaagcagct      3120
     ttcttagatg atatagacgc agatacaaat gatggctcta taataacttc taactttgct      3180
     acagcagtta atttagataa agcaggtgat tatactgtta ctctgaattc tattaatagt      3240
     gatggtgtag cgtctacgcc aactgcaatt attgtccatg tggagaaaga gaaaatagca      3300
     acgattagcg caaatacggc acaacaatat gaaaaatatg cggagattaa tgaaacgcaa      3360
     tttctaaaag atgttcatgc tagtattaac gcgagcccaa caaccgcagt tttggaaagt      3420
     gattttgaaa cagtagttaa actagacgtc ccaggaacgt acacagtaac gattactgct      3480
     acaaatgaag atggcggagt atcggcacca aaagaagttt ctgtcatagt aaaaaaactt      3540
     ccagcgccag aaatcactgc tgataaggaa ataacctatc cgaaatttga tgaagtaagt      3600
     gaagcagaat ttttaagtga tattcatgca actattaatg aaaaaaatgt aacgattaca      3660
     agtaacttca gtgccgatgt gaatttaaat aaagctggcg attacacggt aacattaaat      3720
     gctacgaatg aagacggcgt aaaggctaca ccggttgaag taattgtaca tgttcaacaa      3780
     ggagaacgtc ctgttataac agccgatgca actatttcct atgacaagtt cgctaacata      3840
     acggaagcga agttcttaga agatattcat gcaacaagta gtgatggtca aagctcaact      3900
     gtaatcacct ctaatttcga gaccgcgaca aacttcaaaa cagccatgag ctacacagtt      3960
     acgcttaatg ctgtaaatga agacggcatt agcgcagaac cagtagcagt gaccgttaca      4020
     ataaataaag aaccagccgc gacgttaaaa gctgatgcag aagtaagcta tgcgaaaaat      4080
     gaagctgtaa ccgaatctga tttcttcaaa gatgttcatt tagaaggagc ggaagcccca      4140
     agtacagcaa aagcaacaag taattttgat tccgtagtag atagaagtaa aacaggagat      4200
     tatactgtta cgataaatgc tacaaacgaa gatggggctg tctctacacc aattgaagta      4260
     attgttcaca ttggagcaga aagtgcacca gtaattacag cgaatgcaga agtaaaatat      4320
     aacaaacatg aacaaacaga tgaaagaaga tttttatatg atagtgatgc aaaaatcgat      4380
     gaagctaacg tggaaattaa aaccgatttt gcagaaaaag tagatattaa taaagttgga      4440
     acttatacgg tcacactgac tgctacgaat gaagatggcc aagctgccaa tccagtagaa      4500
     gtaagcgtca ttgtaagtga tgctgctgct gaaaaagtaa atgtgaaata tgtagatgaa      4560
     aatggagcag aaattagtgc agcggagacc ttaactggta atctagatga tgcattttct      4620
     attgacgcga aatctatagc tggatacaaa tgtgatgcca ctttaagcgg cgtattttca      4680
     acagttgagc agacagttgt gtttcattat aaagcaatcg agcctggtgt tgtaacgatt      4740
     aaatacgaag atgcaaatgg aaaagcagtt gccgaagata aacaaataac tggcgaagta      4800
     ggagatgatt ttgaagctga ggcgcaaacg gtgagtggtt attcatgccg agcaattgca      4860
     agtggtaaga taacagaaga accgcaaact attactttca catacactac agcaacgcct      4920
     tccaaaaaat caggcgaaat aacagttcag tatgtagatg agtcaggtaa gaaattggct      4980
     gattctaaaa aggttacagg ggatattgat gatagttata gtgtagaagc caaggcaatt      5040
     gatggctata gcgtagttgg cgatgattct gctaaaggtg tttttaccga aaaatcgcaa      5100
     acagttactt ttaaatacaa gaaaaataca caagttagta aagatgagcc taaagttaaa      5160
     gggaaaacaa accaaccacc aagtgctgat acgaagctaa aagtagacaa taatacgttg      5220
     cctgccaccg gagatactga aaatatggca ttagcagttt taatcggttt taatatgcta      5280
     ctcgttgcta gtatattcct ttttagaaaa ccaaaaacga accaataa                   5328
//

If you have problems or comments...

PBIL Back to PBIL home page