(data stored in ACNUC10821 zone)

EMBL: AE017262.PE347

AE017262.PE347       Location/Qualifiers
FT   CDS_pept        381237..381761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03137"
FT                   /protein_id="AAT03137.1"
FT                   /translation="MNKMIIYSSQYGTSKKYATELSQKKAIPMYSVESIPESIVEADEI
FT                   IYVGAIYMGKVLGFDKFSKNYKTLSSKLIVISAGMYDPTRKENTDNIELTVKENLQKTN
FT                   FLLKDIFCLKGRLDTQQLRLKHKMLVNALYKSAKRKKESDLNDNERDIVRAYEDDSQID
FT                   LNKLDGILDRV"
     atgaataaaa tgattattta ttcaagtcaa tacggcacca gtaagaaata tgcaacagag        60
     cttagtcaga agaaagctat tccaatgtat tctgtggaat ctattcctga atcaatcgtt       120
     gaagccgatg aaatcattta tgttggtgcg atctatatgg gaaaagtact cggatttgat       180
     aagttttcta aaaattataa aactttgtca agtaaattaa tcgttatttc agctggaatg       240
     tatgatccaa cacgcaagga aaatacggat aacatcgaat taacggtcaa agaaaacctt       300
     caaaaaacta attttttatt aaaagacata ttttgtttaa aagggagact agatacacag       360
     caactccgct tgaaacataa aatgttagtc aatgctttat ataagagtgc aaaaagaaaa       420
     aaagagagtg acttaaatga taatgaaaga gatatagtgc gtgcttatga agacgattcg       480
     cagattgatt tgaataagtt agatggtatt ttagatagag tgtag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page