(data stored in ACNUC10821 zone)

EMBL: AE017262.PE348

AE017262.PE348       Location/Qualifiers
FT   CDS_pept        381974..382258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0353"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03138"
FT                   /protein_id="AAT03138.1"
FT                   /translation="MREIKVSEVTFQQHATKLASKSSGRYLPLKNGNMAYSRANSIDQL
FT                   RSALIDLVGVVEDFQHVTKQDAGRLKKMGIAYAKQDQVMGQKINQLEVR"
     atgagagaaa taaaagttag cgaagtaacc ttccaacaac acgcaaccaa attggcaagt        60
     aaaagttcgg gaagatactt accattaaaa aacgggaaca tggcttattc cagagccaat       120
     tcaattgatc aattgcggtc ggcattgatt gatttggtag gcgtagtgga ggattttcaa       180
     cacgtgacca agcaagatgc gggccgatta aagaaaatgg gtattgccta tgccaagcaa       240
     gaccaggtca tgggacaaaa aatcaatcag ttggaggtgc gttaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page