(data stored in ACNUC10821 zone)

EMBL: AE017262.PE349

AE017262.PE349       Location/Qualifiers
FT   CDS_pept        382259..382627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0354"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03139"
FT                   /protein_id="AAT03139.1"
FT                   /translation="MDSAHRQLEQQLQQIKKAKIMAETDVDQTRRKQNEQDWLEEDSHQ
FT                   LTQEKLVLLDFLRSGWQGEEASGFHRFLEEQQHEESQAWRRDLQDKRSDLDTELQENKA
FT                   RLHTLETKQATLQKEWSK"
     ttggatagcg cacaccgcca actagaacaa caactccaac aaattaaaaa agcgaaaata        60
     atggcagaaa cggatgtcga tcaaacgaga agaaaacaaa atgaacaaga ttggttagaa       120
     gaggacagcc accaattaac acaagaaaaa ctggtgttat tagacttttt acgcagtggc       180
     tggcaaggtg aagaagccag tggttttcat cgttttttag aagagcagca acacgaagaa       240
     tctcaggctt ggaggcgtga tcttcaggat aaaagaagcg atttagacac ggaattacaa       300
     gaaaataagg ccaggctcca cacgttagaa accaaacaag ccaccttaca aaaggagtgg       360
     agcaagtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page