(data stored in ACNUC10821 zone)

EMBL: AE017262.PE35

AE017262.PE35        Location/Qualifiers
FT   CDS_pept        complement(37707..38156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37490"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02825"
FT                   /protein_id="AAT02825.1"
FT                   /translation="MIIIKNFASKNIRLIMALVIGVLVFAPVFHSKAADNNIGFDFKLK
FT                   PNCANSGSSSRYRETSSVNNPWKVRLDNSTEGKGTIASFWLGTYNKNKNAVQGSTIMNV
FT                   KQGAKTRYCGAYKVANKNTTYLAAENNNYNSKTYYVDGIWDEETW"
     atgattatca taaaaaattt cgcatcaaaa aacattagac taattatggc actggttatt        60
     ggagtattgg tttttgcacc tgtttttcat tcaaaagccg ctgataataa cattggtttc       120
     gattttaaac tcaaaccaaa ttgcgctaac tcagggtcaa gctcaaggta tagagagact       180
     tcttctgtaa ataacccttg gaaagttcgc ctcgataact caacagaagg aaagggtaca       240
     attgcttctt tttggctagg tacatataat aaaaacaaga atgctgtaca aggctcaaca       300
     ataatgaatg ttaaacaagg tgcaaaaaca cgttattgcg gcgcttataa agtagctaat       360
     aaaaatacaa cctatttagc tgctgaaaat aataattata attccaaaac atactatgtc       420
     gatggtattt gggatgagga aacttggtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page