(data stored in ACNUC10821 zone)

EMBL: AE017262.PE350

AE017262.PE350       Location/Qualifiers
FT   CDS_pept        382624..384060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0354"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF06860"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03140"
FT                   /protein_id="AAT03140.1"
FT                   /translation="MSRIDIAELNDFLHGLRSSNAEAKAMIRKIKEAAMDYAQDNRLKG
FT                   EAVSTSKRYFSSTYTSICQSIIEALDESEERLAQYIREFGSQVDSSPSARIDAEILQEA
FT                   MAKVSQLQRKEEDLHRQLTAPNTKPDMQQVYAVKSRSVHTQLLKAIEKENILERYLAFE
FT                   QSHGQFFSALDELIRATGRAVQELLHHVTFNDKTGTYSVPKSAVNSLLLMKKALDNART
FT                   ENDQDPFPKAFEDYTVLAYTYVNDQGETVTMWLLEKDGKRVENKELQDFLEKHGQELDP
FT                   LLYTNLSGEELERKVNDSWKEGINYLNGQKVSGFSGATLRSSAYVASMKDWTDDAGLTD
FT                   MALGLGFGIAAARNKAIIPKESSGLKFDDIEKLENHFTKHGGEFKGAYSNINEYLKGAN
FT                   NVIKNGEKVQYNYTLKDGTTELRTGYVKFMGNTSKGKAKFEFVGTNLSGDITTYHVKRG
FT                   EDVYKLLNGNKHINVINPIE"
     gtgagccgga tagatattgc ggaattgaat gactttctcc acggtttgcg aagtagtaat        60
     gcggaagcca aagcgatgat tagaaaaatt aaagaagcag cgatggatta cgcccaggac       120
     aatcgtttaa aaggggaagc agttagtacc tccaaacggt atttttctag tacctataca       180
     agtatttgcc agagcatcat tgaggcactg gatgaaagcg aagagcgact agcgcaatat       240
     attcgcgagt tcgggagcca agtggatagt tcgccttctg ccagaattga tgcagaaatc       300
     ttacaagaag cgatggccaa ggttagccag ttacagcgaa aagaagaaga cttgcatcga       360
     caattgacgg cgccgaacac gaagccggat atgcaacaag tctatgcagt gaaatcaaga       420
     agtgttcata cacaattatt gaaggcaatc gaaaaagaga acatcctaga aagatattta       480
     gcttttgaac aaagtcatgg ccagtttttt agtgcgttag acgaactcat tcgagcaacc       540
     ggacgtgcgg tgcaagaatt gctacatcat gtgactttta acgataaaac agggacttat       600
     tccgtgccga aaagtgcggt aaacagcttg ttgcttatga aaaaagcgct ggataacgca       660
     cgaacagaaa atgaccaaga cccctttccg aaagcttttg aagattacac cgtgttagct       720
     tatacttatg tcaatgatca aggcgaaacc gtgacgatgt ggttacttga aaaagatgga       780
     aaacgagtag aaaacaagga attacaagat ttcttagaaa aacatggtca ggaattagac       840
     ccacttcttt ataccaacct ttctggagaa gaactcgaac gaaaagtgaa tgattcttgg       900
     aaagagggta tcaactattt aaatggtcaa aaagtatctg gattttctgg agccacactg       960
     cggtcatccg cttatgtggc tagtatgaaa gattggacag atgatgctgg gttgacagat      1020
     atggcattag gtttagggtt tgggattgca gcagctagaa ataaagcgat aatacctaag      1080
     gaatccagtg gacttaaatt tgacgatata gaaaaattgg aaaaccattt tacaaaacat      1140
     ggaggggagt ttaaaggtgc atattcgaat ataaatgaat atctaaaagg ggcgaataat      1200
     gtaattaaga atggtgaaaa agtacaatat aattatacat tgaaggatgg aacaaccgag      1260
     ttgagaactg gctatgtgaa gtttatgggg aacactagta aaggaaaagc aaaatttgaa      1320
     tttgttggta ctaacttatc tggagatatt acgacctacc atgtgaaacg cggcgaggat      1380
     gtatataaat tattgaatgg aaacaagcat ataaatgtga taaatccaat agaatag         1437
//

If you have problems or comments...

PBIL Back to PBIL home page