(data stored in ACNUC10821 zone)

EMBL: AE017262.PE354

AE017262.PE354       Location/Qualifiers
FT   CDS_pept        385137..385364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03144"
FT                   /protein_id="AAT03144.1"
FT                   /translation="MEYEQMADSLAYGEEYNFYYKNEEYWLSKNREGHYLTKVSDGETQ
FT                   EFRTSEDLLGTARINGKLIIEIWENIQSQF"
     atggaatatg aacaaatggc tgatagttta gcatatggtg aggaatataa tttttactac        60
     aaaaatgagg aatattggtt aagtaaaaat cgggaaggac attacttaac gaaagtatcc       120
     gatggagaaa cacaagaatt taggacttca gaagacttat taggaacagc tagaataaat       180
     ggaaaactta taatagaaat ttgggaaaat atacaaagtc aattctaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page