(data stored in ACNUC10821 zone)

EMBL: AE017262.PE36

AE017262.PE36        Location/Qualifiers
FT   CDS_pept        38379..38717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0028"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02826"
FT                   /protein_id="AAT02826.1"
FT                   /translation="MKVEGLLGFLGAALGIGFSLMVLVIPDISQALEEESFFFYMLTIG
FT                   SLVLSGVGLAGSFIVSHKPRLGGAMMVAAAIGCTMSISIMFLLPIVLLAVGGLIALINY
FT                   EEAASVEE"
     atgaaagttg aaggattact tggcttttta ggggcggcac tgggtattgg atttagtttg        60
     atggttctag ttattcctga tatttcacag gcattagaag aggagtcatt tttcttctat       120
     atgttaacga ttggttcact tgtgctttct ggagtgggac ttgcgggatc gtttattgtt       180
     tcgcataagc cgcgtcttgg tggggcaatg atggtggcag ctgcaattgg ctgtacaatg       240
     tcaatttcga ttatgttctt actgccaatc gtactacttg ctgttggcgg attaattgca       300
     ttaattaact atgaagaagc tgcttccgta gaagaataa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page