(data stored in ACNUC10821 zone)

EMBL: AE017262.PE364

AE017262.PE364       Location/Qualifiers
FT   CDS_pept        complement(391861..392856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0368"
FT                   /product="dihydroxyacetone kinase"
FT                   /note="identified by similarity to GP:15082277; match to
FT                   protein family HMM PF02733"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03154"
FT                   /protein_id="AAT03154.1"
FT                   /translation="MRRLVNDGYEAVEEMLAGYVAAQGKYVDFAENDKRVIVSKQMSEE
FT                   PRVRIIVGGGSGHEPLFLGYVGKDFADAAVVGNINTSPSPEPCYNAVKAVDSGKGCLYM
FT                   YGNYAGDVMNFDMGAEMAADDGIRVETVLVTDDIYSAENVEDRRGVAGDLIVFKAAASA
FT                   AAKGLDLDAVKQAAEKANANTFSMGVALSSSTLPVTGKAIFEMKEGEMEVGMGIHGEPG
FT                   IKRTSIEPADKVVDQIMGYLIEEMKLTADEEVHVLINGLGGLPVMDQYICYRRVDEILK
FT                   EKGVHIHNPLVGNYATSMDMIGMSITLVRLDDELKDLLDTPCDTPYFKVD"
     atgagacgtt tagtgaatga tgggtatgaa gcagtagaag aaatgttagc tggttatgtt        60
     gcggcacaag ggaaatacgt agattttgca gaaaatgata agcgagtaat cgtaagcaaa       120
     caaatgagcg aagaaccccg tgtgcggatt attgttggtg gcggttctgg tcatgaacca       180
     cttttccttg gttatgttgg gaaagatttc gcggatgcgg cggtagttgg gaacattaat       240
     acttcccctt ctccagaacc ttgttataac gcagtaaaag ccgttgatag cggtaaaggt       300
     tgtctatata tgtacggaaa ttatgctggc gatgtgatga actttgatat gggcgctgaa       360
     atggctgcgg acgacggtat tcgcgttgaa acagtgcttg taacagatga tatttactct       420
     gctgaaaatg tagaagatcg tcgtggtgtg gctggtgact taattgtatt taaagcagcg       480
     gcatctgcag cagcaaaagg acttgaccta gatgcggtga aacaagctgc tgaaaaagct       540
     aatgcaaata cgttctcgat gggtgttgcg ctttcttctt ctacccttcc tgtaactggt       600
     aaagctattt tcgaaatgaa agaaggcgaa atggaagttg gtatgggaat ccacggtgaa       660
     ccaggaatca aacgtacttc catcgaacca gctgataaag tggttgatca aattatgggc       720
     tatcttatag aagaaatgaa attaactgcg gatgaagaag tgcatgtact tattaatgga       780
     cttggcggtt taccagtgat ggatcaatat atttgttatc gccgcgtcga tgaaattttg       840
     aaagaaaaag gcgtgcatat tcataaccca cttgttggga actacgcgac ttcgatggat       900
     atgattggta tgtcgattac actggttcgt ttagacgatg aactgaaaga tcttttagat       960
     acaccgtgcg acacaccata tttcaaagtg gactaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page