(data stored in ACNUC10821 zone)

EMBL: AE017262.PE366

AE017262.PE366       Location/Qualifiers
FT   CDS_pept        complement(393235..393666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0366"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03156"
FT                   /protein_id="AAT03156.1"
FT                   /translation="MKFFRGMIGFCIAGMIVMSVWTPLAENYGIFGGYLAAFIIIGPMW
FT                   FMNHYVGLIENDEDAAFVDMAVGIGICGIMRDVFMQGGGELVSSLPTIGLVAIGAVLAG
FT                   IVAAAIEKDMAKKQEAKQEKTEPGMNMKEEERLNENQLV"
     atgaaattct ttagaggaat gattggtttt tgtatcgcag gtatgattgt tatgagtgtt        60
     tggactccac ttgccgagaa ttatggtatt tttggaggtt atctggcagc tttcattatt       120
     attggtccaa tgtggtttat gaatcactat gttggtttaa tcgaaaatga tgaagacgca       180
     gcgtttgttg atatggctgt cggaattggg atttgcggaa ttatgcgtga tgtctttatg       240
     caaggtggtg gcgagttagt aagttcgctt ccaacgattg gtcttgttgc gattggagca       300
     gttctagctg gaatcgtggc cgcagcaatt gaaaaagata tggcaaaaaa acaagaagca       360
     aaacaagaaa aaacagaacc tggcatgaat atgaaagaag aagagcgttt aaacgaaaat       420
     caattagtct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page