(data stored in ACNUC10821 zone)

EMBL: AE017262.PE368

AE017262.PE368       Location/Qualifiers
FT   CDS_pept        394311..395075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0372"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03158"
FT                   /protein_id="AAT03158.1"
FT                   /translation="MFPFERQNKIIHLLDQNSKITVPELSRILDVSISTIRNDLSSLEE
FT                   SGMIKKVHGGAVLLKSEEKFTNFNDRIIRNIEEKEAIAKEAATLVKNNQTIILDASSTA
FT                   LALAKELHGFSRLTVITSGLYTAIELKDNPNISVILTGGIVTTNSFTLEGILGANLIEN
FT                   IHADLCFMSAKGFTMEEGLTDFNIYETELKRLLAKRTNKLIALLDHTKMGVISTASITA
FT                   AENIDLLITDNKINKALYKKFQDAGLPVKIAE"
     atgtttccat ttgaaagaca aaacaaaata attcatctac tagaccaaaa tagcaaaata        60
     actgtaccag aattaagtcg tatcttggat gtctcgatta gtaccatccg aaatgattta       120
     tcttcattag aagaaagcgg gatgattaaa aaagtacacg ggggtgcggt acttttaaag       180
     agcgaagaga aatttactaa ttttaatgac cggattattc gcaacatcga agaaaaagaa       240
     gcgattgcga aagaagcggc aactttagta aaaaacaatc aaacaattat cctagatgcc       300
     agctcgactg cactggcgct tgcaaaagag ttacatggtt tttcaaggct gactgtcata       360
     acaagcggac tttatacagc aatcgaacta aaagacaacc cgaatatcag cgttatttta       420
     actggcggga ttgtgacgac gaactctttt acactggaag ggattcttgg cgcgaattta       480
     attgaaaaca tccatgccga tttatgtttt atgtcagcaa aaggttttac aatggaagaa       540
     ggcttaactg atttcaacat ttatgaaact gaactaaaac gacttcttgc taaacgtact       600
     aacaaattga tcgcactttt agatcataca aaaatgggcg taatctccac cgcaagcatt       660
     acagcagcag aaaacatcga tttactaatt acagataaca aaataaataa agcattatat       720
     aaaaaattcc aagatgcagg acttcctgtc aaaattgcgg aataa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page