(data stored in ACNUC10821 zone)

EMBL: AE017262.PE37

AE017262.PE37        Location/Qualifiers
FT   CDS_pept        complement(38754..39563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0039"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by similarity to GP:16412450; match to
FT                   protein family HMM PF00702; match to protein family HMM
FT                   TIGR00099; match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02827"
FT                   /protein_id="AAT02827.1"
FT                   /translation="MEKYLICSDLDGTLLLKNQTISPKTLNLLQQLIEEGHHFAVSTGR
FT                   MYNSATDFANLVHPKADVIASNGGVVAVSGEIILQEKMKQSALLETFLLCQNHDLPVFF
FT                   FSTDTVYYTKNPPYYFTDEEDKGRVNATKLVPIKTKESFLEHADQFINGIVIEEEDFDK
FT                   LAALRSELEKLSDVSILSSHANNIEILPKDMDKKYAVKNLAAHLNIKPENVITFGDGEN
FT                   DIGMLEVAGAGVAMENASELVKKSADFVTTANDADGIYYFLKKYLNR"
     ttggaaaaat acttaatttg ttctgattta gacgggacat tactacttaa aaaccaaact        60
     atctcaccaa aaacactaaa tttattgcaa caactaatag aagaaggtca tcattttgcc       120
     gtttctaccg gtcgaatgta taattccgca acagacttcg ccaacctcgt tcatccaaaa       180
     gcagatgtca ttgcttcaaa cggcggtgta gttgcagtat caggcgaaat tatcctacaa       240
     gaaaaaatga aacaatctgc gttactcgag acatttttat tgtgccaaaa tcatgattta       300
     cctgtgtttt tcttttcaac agatactgtt tactacacta aaaatccccc atattatttt       360
     acggatgaag aagataaagg ccgcgtaaat gctacaaaac tcgttcctat caaaacaaaa       420
     gaaagcttcc ttgagcatgc ggaccagttc attaatggga ttgtaatcga ggaagaagat       480
     ttcgacaaac tcgcagccct tcgaagtgag ctagaaaaac tatccgatgt ttctatcctt       540
     tcttcccatg ccaataatat cgagatctta ccaaaagata tggataaaaa atacgccgtg       600
     aaaaatctcg ctgcacattt aaatatcaag ccagaaaatg taattacttt tggtgatggt       660
     gaaaatgata ttgggatgct tgaagttgct ggcgcagggg ttgcgatgga aaatgcaagt       720
     gaactagtga aaaaaagtgc tgattttgtt actactgcaa atgatgccga tggaatttac       780
     tactttttga aaaaatatct taatcgttaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page